Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.70
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Chronic Obstructive Airway Disease 47
Disease Target Count P-value
breast carcinoma 1614 4.97014017045861E-31
Breast cancer 3099 8.91344181605961E-22
ductal carcinoma in situ 1745 2.09042541020041E-5
glioblastoma 5572 2.11959221957337E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.14702127916045E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.53440433789481E-5
pediatric high grade glioma 2712 6.02792956549921E-5
invasive ductal carcinoma 2950 1.19165628394447E-4
ependymoma 2514 1.27682730771191E-4
group 4 medulloblastoma 1875 4.32593166017397E-4
atypical teratoid / rhabdoid tumor 4369 6.19987719804471E-4
acute quadriplegic myopathy 1157 6.89911383491137E-4
ovarian cancer 8492 0.00202863090788189
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00608124935618683
medulloblastoma, large-cell 6234 0.0124781208400579
adrenocortical carcinoma 1427 0.0125280434807774
primitive neuroectodermal tumor 3031 0.0165385017596225
subependymal giant cell astrocytoma 2287 0.0321705213862981
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 3.003 1.5

Expression

Synonym

Accession Q9ULK6 Q3T1D0 Q6ZNW6
Symbols

Gene

  Ortholog (11)

Pathway (1)

Gene RIF (2)

PMID Text
25609945 rs10007052 in the RNF150 gene is significantly associated with the risk of COPD in Chinese populations of Hainan province.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAMSLIQACCSLALSTWLLSFCFVHLLCLDFTVAEKEEWYTAFVNITYAEPAPDPGAGAAGGGGAELHTE      1 - 70
KTECGRYGEHSPKQDARGEVVMASSAHDRLACDPNTKFAAPTRGKNWIALIPKGNCTYRDKIRNAFLQNA     71 - 140
SAVVIFNVGSNTNETITMPHAGVEDIVAIMIPEPKGKEIVSLLERNITVTMYITIGTRNLQKYVSRTSVV    141 - 210
FVSISFIVLMIISLAWLVFYYIQRFRYANARDRNQRRLGDAAKKAISKLQIRTIKKGDKETESDFDNCAV    211 - 280
CIEGYKPNDVVRILPCRHLFHKSCVDPWLLDHRTCPMCKMNILKALGIPPNADCMDDLPTDFEGSLGGPP    281 - 350
TNQITGASDTTVNESSVTLDPAVRTVGALQVVQDTDPIPQEGDVIFTTNSEQEPAVSSDSDISLIMAMEV    351 - 420
GLSDVELSTDQDCEEVKS                                                        421 - 438
//

Text Mined References (8)

PMID Year Title
25609945 2015 EGLN2 and RNF150 genetic variants are associated with chronic obstructive pulmonary disease risk in the Chinese population.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.