Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.70
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25609945 rs10007052 in the RNF150 gene is significantly associated with the risk of COPD in Chinese populations of Hainan province.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAMSLIQACCSLALSTWLLSFCFVHLLCLDFTVAEKEEWYTAFVNITYAEPAPDPGAGAAGGGGAELHTE      1 - 70
KTECGRYGEHSPKQDARGEVVMASSAHDRLACDPNTKFAAPTRGKNWIALIPKGNCTYRDKIRNAFLQNA     71 - 140
SAVVIFNVGSNTNETITMPHAGVEDIVAIMIPEPKGKEIVSLLERNITVTMYITIGTRNLQKYVSRTSVV    141 - 210
FVSISFIVLMIISLAWLVFYYIQRFRYANARDRNQRRLGDAAKKAISKLQIRTIKKGDKETESDFDNCAV    211 - 280
CIEGYKPNDVVRILPCRHLFHKSCVDPWLLDHRTCPMCKMNILKALGIPPNADCMDDLPTDFEGSLGGPP    281 - 350
TNQITGASDTTVNESSVTLDPAVRTVGALQVVQDTDPIPQEGDVIFTTNSEQEPAVSSDSDISLIMAMEV    351 - 420
GLSDVELSTDQDCEEVKS                                                        421 - 438
//

Text Mined References (8)

PMID Year Title
25609945 2015 EGLN2 and RNF150 genetic variants are associated with chronic obstructive pulmonary disease risk in the Chinese population.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.