Property Summary

NCBI Gene PubMed Count 34
Grant Count 65
R01 Count 44
Funding $6,779,321.42
PubMed Score 30.05
PubTator Score 24.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.400 0.015
ependymoma 1.600 0.006
oligodendroglioma 1.600 0.006
osteosarcoma -2.116 0.000
group 3 medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
medulloblastoma, large-cell 1.500 0.001
tuberculosis and treatment for 6 months 1.300 0.002
Breast cancer 3.700 0.022
ovarian cancer -1.800 0.000
pituitary cancer 1.100 0.007

Synonym

Accession Q9ULK4 B9TX55 O95403 Q5JWT3 Q5JWT4 Q6P9H6 Q9H0J2 Q9NTT9 Q9NTU0 Q9Y5P7 Q9Y667
Symbols SUR2
CRSP3
MRT18
SUR-2
ARC130
CRSP130
CRSP133
DRIP130

Gene

Gene RIF (13)

PMID Text
26152846 In Title.
25845469 MED23-associated intellectual disability has been found in two brothers from a non-consanguineous family.
25684393 MED23 plays an important role in hepatocarcinogenesis, and it may be a novel target for HCC therapy.
25273169 Upregulation of mediator MED23 in non-small-cell lung cancer promotes the growth, migration, and metastasis of cancer cells.
23340209 Mediator MED23 regulates basal transcription in vivo via an interaction with P-TEFb.
22988093 Data show that Med23 RNAi specifically inhibits the proliferation and tumorigenicity of lung cancer cells with hyperactive Ras activity.
21868677 missense mutation (p. R617Q) in MED23 that cosegregates with nonsyndromic autosomal recessive intellectual disability; mutation impaired response of JUN and FOS to mitogens by altering interaction between enhancer-bound transcription factors and Mediator
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

METQLQSIFEEVVKTEVIEEAFPGMFMDTPEDEKTKLISCLGAFRQFWGGLSQESHEQCIQWIVKFIHGQ      1 - 70
HSPKRISFLYDCLAMAVETGLLPPRLVCESLINSDTLEWERTQLWALTFKLVRKIIGGVDYKGVRDLLKV     71 - 140
ILEKILTIPNTVSSAVVQQLLAAREVIAYILERNACLLPAYFAVTEIRKLYPEGKLPHWLLGNLVSDFVD    141 - 210
TFRPTARINSICGRCSLLPVVNNSGAICNSWKLDPATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSR    211 - 280
DMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDGGTSQLLWQHLSSQLIFFVLFQFASFP    281 - 350
HMVLSLHQKLAGRGLIKGRDHLMWVLLQFISGSIQKNALADFLPVMKLFDLLYPEKEYIPVPDINKPQST    351 - 420
HAFAMTCIWIHLNRKAQNDNSKLQIPIPHSLRLHHEFLQQSLRNKSLQMNDYKIALLCNAYSTNSECFTL    421 - 490
PMGALVETIYGNGIMRIPLPGTNCMASGSITPLPMNLLDSLTVHAKMSLIHSIATRVIKLAHAKSSVALA    491 - 560
PALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL    561 - 630
AAVAQTNQNQLHLCVESTALRLITALGSSEVQPQFTRFLSDPKTVLSAESEELNRALILTLARATHVTDF    631 - 700
FTGSDSIQGTWCKDILQTIMSFTPHNWASHTLSCFPGPLQAFFKQNNVPQESRFNLKKNVEEEYRKWKSM    701 - 770
SNENDIITHFSMQGSPPLFLCLLWKMLLETDHINQIGYRVLERIGARALVAHVRTFADFLVYEFSTSAGG    771 - 840
QQLNKCIEILNDMVWKYNIVTLDRLILCLAMRSHEGNEAQVCYFIIQLLLLKPNDFRNRVSDFVKENSPE    841 - 910
HWLQNDWHTKHMNYHKKYPEKLYFEGLAEQVDPPVQIQSPYLPIYFGNVCLRFLPVFDIVIHRFLELLPV    911 - 980
SKSLETLLDHLGGLYKFHDRPVTYLYNTLHYYEMHLRDRAFLKRKLVHAIIGSLKDNRPQGWCLSDTYLK    981 - 1050
CAMNAREENPWVPDDTYYCRLIGRLVDTMAGKSPGPFPNCDWRFNEFPNPAAHALHVTCVELMALAVSGK   1051 - 1120
EVGNALLNVVLKSQPLVPRENITAWMNAIGLIITALPEPYWIVLHDRIVSVISSPSLTSETEWVGYPFRL   1121 - 1190
FDFTACHQSYSEMSCSYTLALAHAVWHHSSIGQLSLIPKFLTEVLLPIVKTEFQLLYVYHLVGPFLQRFQ   1191 - 1260
QERTRCMIEIGVAFYDMLLNVDQCSTHLNYMDPICDFLYHMKYMFTGDSVKEQVEKIICNLKPALKLRLR   1261 - 1330
FITHISKMEPAAVPPQAMNSGSPAPQSNQVPVSLPVTQ                                   1331 - 1368
//

Text Mined References (42)

PMID Year Title
26152846 2015 Mutational Heterogeneity of MED23 Gene in Colorectal Cancers.
25845469 2015 MED23-associated intellectual disability in a non-consanguineous family.
25684393 2015 Mediator subunit 23 overexpression as a novel target for suppressing proliferation and tumorigenesis in hepatocellular carcinoma.
25273169 2014 Upregulation of mediator MED23 in non-small-cell lung cancer promotes the growth, migration, and metastasis of cancer cells.
25245031 2014 Genome-wide association study of L-arginine and dimethylarginines reveals novel metabolic pathway for symmetric dimethylarginine.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
23340209 Mediator MED23 regulates basal transcription in vivo via an interaction with P-TEFb.
22988093 2012 Selective requirement for Mediator MED23 in Ras-active lung cancer.
21868677 2011 MED23 mutation links intellectual disability to dysregulation of immediate early gene expression.
21269460 2011 Initial characterization of the human central proteome.
More...