Property Summary

NCBI Gene PubMed Count 37
PubMed Score 34.20
PubTator Score 24.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.400 1.5e-02
atypical teratoid / rhabdoid tumor 1.500 8.3e-06
Breast cancer 3.700 2.2e-02
ependymoma 1.600 5.6e-03
group 3 medulloblastoma 2.000 2.5e-06
medulloblastoma, large-cell 1.500 6.8e-04
oligodendroglioma 1.600 5.5e-03
osteosarcoma -2.116 3.1e-07
ovarian cancer -1.800 1.1e-08
pituitary cancer 1.100 7.1e-03
tuberculosis and treatment for 6 months 1.300 2.0e-03

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

METQLQSIFEEVVKTEVIEEAFPGMFMDTPEDEKTKLISCLGAFRQFWGGLSQESHEQCIQWIVKFIHGQ      1 - 70
HSPKRISFLYDCLAMAVETGLLPPRLVCESLINSDTLEWERTQLWALTFKLVRKIIGGVDYKGVRDLLKV     71 - 140
ILEKILTIPNTVSSAVVQQLLAAREVIAYILERNACLLPAYFAVTEIRKLYPEGKLPHWLLGNLVSDFVD    141 - 210
TFRPTARINSICGRCSLLPVVNNSGAICNSWKLDPATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSR    211 - 280
DMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDGGTSQLLWQHLSSQLIFFVLFQFASFP    281 - 350
HMVLSLHQKLAGRGLIKGRDHLMWVLLQFISGSIQKNALADFLPVMKLFDLLYPEKEYIPVPDINKPQST    351 - 420
HAFAMTCIWIHLNRKAQNDNSKLQIPIPHSLRLHHEFLQQSLRNKSLQMNDYKIALLCNAYSTNSECFTL    421 - 490
PMGALVETIYGNGIMRIPLPGTNCMASGSITPLPMNLLDSLTVHAKMSLIHSIATRVIKLAHAKSSVALA    491 - 560
PALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL    561 - 630
AAVAQTNQNQLHLCVESTALRLITALGSSEVQPQFTRFLSDPKTVLSAESEELNRALILTLARATHVTDF    631 - 700
FTGSDSIQGTWCKDILQTIMSFTPHNWASHTLSCFPGPLQAFFKQNNVPQESRFNLKKNVEEEYRKWKSM    701 - 770
SNENDIITHFSMQGSPPLFLCLLWKMLLETDHINQIGYRVLERIGARALVAHVRTFADFLVYEFSTSAGG    771 - 840
QQLNKCIEILNDMVWKYNIVTLDRLILCLAMRSHEGNEAQVCYFIIQLLLLKPNDFRNRVSDFVKENSPE    841 - 910
HWLQNDWHTKHMNYHKKYPEKLYFEGLAEQVDPPVQIQSPYLPIYFGNVCLRFLPVFDIVIHRFLELLPV    911 - 980
SKSLETLLDHLGGLYKFHDRPVTYLYNTLHYYEMHLRDRAFLKRKLVHAIIGSLKDNRPQGWCLSDTYLK    981 - 1050
CAMNAREENPWVPDDTYYCRLIGRLVDTMAGKSPGPFPNCDWRFNEFPNPAAHALHVTCVELMALAVSGK   1051 - 1120
EVGNALLNVVLKSQPLVPRENITAWMNAIGLIITALPEPYWIVLHDRIVSVISSPSLTSETEWVGYPFRL   1121 - 1190
FDFTACHQSYSEMSCSYTLALAHAVWHHSSIGQLSLIPKFLTEVLLPIVKTEFQLLYVYHLVGPFLQRFQ   1191 - 1260
QERTRCMIEIGVAFYDMLLNVDQCSTHLNYMDPICDFLYHMKYMFTGDSVKEQVEKIICNLKPALKLRLR   1261 - 1330
FITHISKMEPAAVPPQAMNSGSPAPQSNQVPVSLPVTQ                                   1331 - 1368
//

Text Mined References (45)

PMID Year Title