Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.40
PubTator Score 9.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 5.4381902345924E-13
non-small cell lung cancer 2798 3.88495029108709E-11
ovarian cancer 8492 6.06516440411841E-9
malignant mesothelioma 3163 3.75470799494705E-7
Pick disease 1893 2.39180573551945E-6
interstitial cystitis 2299 2.49381718289237E-6
atypical teratoid / rhabdoid tumor 4369 1.01703043421208E-5
sonic hedgehog group medulloblastoma 1482 4.02345400866911E-5
Amyotrophic Lateral Sclerosis 432 9.62008432459181E-5
pilocytic astrocytoma 3086 3.34580706400833E-4
pediatric high grade glioma 2712 4.9580613816444E-4
pituitary cancer 1972 5.89820064412105E-4
lung cancer 4473 7.4745669222963E-4
glioblastoma 5572 0.00154712313497917
breast carcinoma 1614 0.00267452572037301
medulloblastoma, large-cell 6234 0.00490131868801
ependymoma 2514 0.0338609715716339
progressive supranuclear palsy 674 0.0353582770736475

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
ependymoma -1.600 0.034
glioblastoma -2.400 0.002
sonic hedgehog group medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.800 0.005
Amyotrophic Lateral Sclerosis 1.014 0.000
non-small cell lung cancer -1.636 0.000
lung cancer 1.800 0.001
breast carcinoma -1.100 0.003
interstitial cystitis -3.200 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.100 0.000
lung carcinoma 1.100 0.000
Pick disease 2.300 0.000
progressive supranuclear palsy 1.600 0.035
ovarian cancer 1.100 0.000
pituitary cancer 1.100 0.001

Synonym

Accession Q9ULJ8 A1L494 B2RWQ1 E9PCA0 E9PCK6 E9PDX1 F8W7J9 O76059 Q9NXT2
Symbols NRB1
NRBI
Neurabin-I

Gene

PDB

1WF8  

  Ortholog (6)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

 GO Function (1)

Pathway (1)

Gene RIF (7)

PMID Text
25757715 MARCKS and PPP1R9A might contribute to spine loss in schizophrenia and bipolar disorder through their interactions.
25057852 CHN2, ABCB1 and PPP1R9A expression on chromosome 7 is implicated in the pathogenesis of hepatosplenic T-cell lymphoma distinguishing it from other malignancies.
22284538 Studies suggest that any change in substrate specificity of the spinophilin : PP1 holoenzyme complex was probably due to direct modification of a PP1 substrate binding surface.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20423481 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15286155 PPP1R9A gene is imprinted, with preferential expression from the maternal allele in embryonic skeletal muscle and extra-embryonic tissues, but biallelic expression in other embryonic tissues.

AA Sequence

MLKTESSGERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGRKYGSNVNRIKNLF      1 - 70
MQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERISRFDTMYDGPSYSKFT     71 - 140
ETRKMFERSVHESGQNNRYSPKKEKAGGSEPQDEWGGSKSNRGSTDSLDSLSSRTEAVSPTVSQLSAVFE    141 - 210
NTDSPSAIISEKAENNEYSVTGHYPLNLPSVTVTNLDTFGHLKDSNSWPPSNKRGVDTEDAHKSNATPVP    211 - 280
EVASKSTSLASIPGEEIQQSKEPEDSTSNQQTPDSIDKDGPEEPCAESKAMPKSEIPSPQSQLLEDAEAN    281 - 350
LVGREAAKQQRKELAGGDFTSPDASASSCGKEVPEDSNNFDGSHVYMHSDYNVYRVRSRYNSDWGETGTE    351 - 420
QDEEEDSDENSYYQPDMEYSEIVGLPEEEEIPANRKIKFSSAPIKVFNTYSNEDYDRRNDEVDPVAASAE    421 - 490
YELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEV    491 - 560
DGISLVGVTQNFAATVLRNTKGNVRFVIGREKPGQVSEVAQLISQTLEQERRQRELLEQHYAQYDADDDE    561 - 630
TGEYATDEEEDEVGPVLPGSDMAIEVFELPENEDMFSPSELDTSKLSHKFKELQIKHAVTEAEIQKLKTK    631 - 700
LQAAENEKVRWELEKTQLQQNIEENKERMLKLESYWIEAQTLCHTVNEHLKETQSQYQALEKKYNKAKKL    701 - 770
IKDFQQKELDFIKRQEAERKKIEDLEKAHLVEVQGLQVRIRDLEAEVFRLLKQNGTQVNNNNNIFERRTS    771 - 840
LGEVSKGDTMENLDGKQTSCQDGLSQDLNEAVPETERLDSKALKTRAQLSVKNRRQRPSRTRLYDSVSST    841 - 910
DGEDSLERKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMIDDEILDDGQSPKHSQC    911 - 980
QNRAVQEWSVQQVSHWLMSLNLEQYVSEFSAQNITGEQLLQLDGNKLKALGMTASQDRAVVKKKLKEMKM    981 - 1050
SLEKARKAQEKMEKQREKLRRKEQEQMQRKSKKTEKMTSTTAEGAGEQ                         1051 - 1098
//

Text Mined References (20)

PMID Year Title
25757715 2015 Altered prefrontal cortical MARCKS and PPP1R9A mRNA expression in schizophrenia and bipolar disorder.
25057852 2014 Integrative genomic and transcriptomic analysis identified candidate genes implicated in the pathogenesis of hepatosplenic T-cell lymphoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22284538 2013 Structural basis for protein phosphatase 1 regulation and specificity.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20423481 2010 Lack of replication of genetic predictors for the rheumatoid arthritis response to anti-TNF treatments: a prospective case-only study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...