Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.40
PubTator Score 9.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.500 3.9e-04
Amyotrophic lateral sclerosis 1.014 9.6e-05
Astrocytoma, Pilocytic -1.100 3.0e-04
atypical teratoid / rhabdoid tumor -1.400 1.6e-02
breast carcinoma -1.100 2.7e-03
ependymoma -1.300 2.1e-02
glioblastoma -1.400 4.7e-04
group 4 medulloblastoma -1.300 2.5e-03
interstitial cystitis -2.200 3.3e-04
lung cancer 1.800 7.5e-04
lung carcinoma 1.100 5.4e-13
malignant mesothelioma 2.000 3.8e-07
medulloblastoma, large-cell -1.800 4.9e-03
non-small cell lung cancer -1.636 3.9e-11
ovarian cancer 1.100 6.1e-09
Pick disease 2.300 2.4e-06
pituitary cancer 1.100 5.9e-04
progressive supranuclear palsy 1.600 3.5e-02

Gene RIF (7)

AA Sequence

MLKTESSGERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGRKYGSNVNRIKNLF      1 - 70
MQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERISRFDTMYDGPSYSKFT     71 - 140
ETRKMFERSVHESGQNNRYSPKKEKAGGSEPQDEWGGSKSNRGSTDSLDSLSSRTEAVSPTVSQLSAVFE    141 - 210
NTDSPSAIISEKAENNEYSVTGHYPLNLPSVTVTNLDTFGHLKDSNSWPPSNKRGVDTEDAHKSNATPVP    211 - 280
EVASKSTSLASIPGEEIQQSKEPEDSTSNQQTPDSIDKDGPEEPCAESKAMPKSEIPSPQSQLLEDAEAN    281 - 350
LVGREAAKQQRKELAGGDFTSPDASASSCGKEVPEDSNNFDGSHVYMHSDYNVYRVRSRYNSDWGETGTE    351 - 420
QDEEEDSDENSYYQPDMEYSEIVGLPEEEEIPANRKIKFSSAPIKVFNTYSNEDYDRRNDEVDPVAASAE    421 - 490
YELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTEGGAAQRDGRIQVNDQIVEV    491 - 560
DGISLVGVTQNFAATVLRNTKGNVRFVIGREKPGQVSEVAQLISQTLEQERRQRELLEQHYAQYDADDDE    561 - 630
TGEYATDEEEDEVGPVLPGSDMAIEVFELPENEDMFSPSELDTSKLSHKFKELQIKHAVTEAEIQKLKTK    631 - 700
LQAAENEKVRWELEKTQLQQNIEENKERMLKLESYWIEAQTLCHTVNEHLKETQSQYQALEKKYNKAKKL    701 - 770
IKDFQQKELDFIKRQEAERKKIEDLEKAHLVEVQGLQVRIRDLEAEVFRLLKQNGTQVNNNNNIFERRTS    771 - 840
LGEVSKGDTMENLDGKQTSCQDGLSQDLNEAVPETERLDSKALKTRAQLSVKNRRQRPSRTRLYDSVSST    841 - 910
DGEDSLERKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMIDDEILDDGQSPKHSQC    911 - 980
QNRAVQEWSVQQVSHWLMSLNLEQYVSEFSAQNITGEQLLQLDGNKLKALGMTASQDRAVVKKKLKEMKM    981 - 1050
SLEKARKAQEKMEKQREKLRRKEQEQMQRKSKKTEKMTSTTAEGAGEQ                         1051 - 1098
//

Text Mined References (22)

PMID Year Title