Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.78
PubTator Score 0.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 3.700 3.3e-02
diabetes mellitus -1.500 1.7e-03
ependymoma -1.100 1.6e-02
group 3 medulloblastoma 2.100 5.1e-05
interstitial cystitis -1.400 3.5e-03
ovarian cancer -2.000 1.0e-06
pancreatic cancer 1.100 5.9e-04
pancreatic carcinoma 1.100 5.9e-04
pituitary cancer 2.400 8.9e-07
primary pancreatic ductal adenocarcinoma 1.378 2.5e-03
tuberculosis 1.200 1.1e-03

Gene RIF (1)

AA Sequence

MTNPWEEKVCKMAQTSLLQGKQFYCREWVFHKLQHCLQEKSNCCNSAVNAPSLVMNSGNNASGVSGKGAA      1 - 70
WGVLLVGGPGSGKTALCTELLWPSSPASLQRGLHRQALAFHFCKAQDSDTLCVGGFIRGLVAQICRSGLL     71 - 140
QGYEDKLRDPAVQSLLQPGECERNPAEAFKRCVLLPLLGMKPPQQSLYLLVDSVDEGCNITEGEQTSTSL    141 - 210
SGTVAALLAGHHEFFPPWLLLLCSARKQSKAVTKMFTGFRKISLDDLRKAYIVKDVQQYILHRLDQEEAL    211 - 280
RQHLTKETAEMLNQLHIKSSGCFLYLERVLDGVVENFIMLREIRDIPGTLNGLYLWLCQRLFVRKQFAKV    281 - 350
QPILNVILAACRPLTITELYHAVWTKNMSLTLEDFQRKLDILSKLLVDGLGNTKILFHYSFAEWLLDVKH    351 - 420
CTQKYLCNAAEGHRMLAMSYTCQAKNLTPLEAQEFALHLINSNLQLETAELALWMIWNGTPVRDSLSTLI    421 - 490
PKEQEVLQLLVKAGAHVNSEDDRTSCIVRQALEREDSIRTLLDNGASVNQCDSNGRTLLANAAYSGSLDV    491 - 560
VNLLVSRGADLEIEDAHGHTPLTLAARQGHTKVVNCLIGCGANINHTDQDGWTALRSAAWGGHTEVVSAL    561 - 630
LYAGVKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHG    631 - 700
AEVNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEG    701 - 770
GADVDHTDNNGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDE    771 - 840
NHRDDAGWTPLHMAAFEGHRLICEALIEQGARTNEIDNDGRIPFILASQEGHYDCVQILLENKSNIDQRG    841 - 910
YDGRNALRVAALEGHRDIVELLFSHGADVNCKDADGRPTLYILALENQLTMAEYFLENGANVEASDAEGR    911 - 980
TALHVSCWQGHMEMVQVLIAYHADVNAADNEKRSALQSAAWQGHVKVVQLLIEHGAVVDHTCNQGATALC    981 - 1050
IAAQEGHIDVVQVLLEHGADPNHADQFGRTAMRVAAKNGHSQIIKLLEKYGASSLNGCSPSPVHTMEQKP   1051 - 1120
LQSLSSKVQSLTIKSNSSGSTGGGDMQPSLRGLPNGPTHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNS   1121 - 1190
SLRTTSSTATAQTVPIDSFHNLSFTEQIQQHSLPRSRSRQSIVSPSSTTQSLGQSHNSPSSEFEWSQVKP   1191 - 1260
SLKSTKASKGGKSENSAKSGSAGKKAKQSNSSQPKVLEYEMTQFDRRGPIAKSGTAAPPKQMPAESQCKI   1261 - 1330
MIPSAQQEIGRSQQQFLIHQQSGEQKKRNGIMTNPNYHLQSNQVFLGRVSVPRTMQDRGHQEVLEGYPSS   1331 - 1400
ETELSLKQALKLQIEGSDPSFNYKKETPL                                            1401 - 1429
//

Text Mined References (12)

PMID Year Title