Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.78
PubTator Score 0.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
pituitary cancer 1972 8.91646894046746E-7
ovarian cancer 8492 1.00168066316949E-6
group 3 medulloblastoma 2254 5.11067567803766E-5
tuberculosis and treatment for 6 months 686 1.19391200780425E-4
pancreatic carcinoma 567 5.93608473275185E-4
diabetes mellitus 1663 0.00174232782980674
primary pancreatic ductal adenocarcinoma 1271 0.00249531330040643
interstitial cystitis 2299 0.00347537634757655
pancreatic cancer 2300 0.0140891327676777
ependymoma 2514 0.0160595292611923
Breast cancer 3099 0.0326515274440075
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Mental depression 58 0.0 1.0

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.200 0.014
ependymoma -1.100 0.016
group 3 medulloblastoma 2.100 0.000
primary pancreatic ductal adenocarcinoma 1.378 0.002
tuberculosis and treatment for 6 months 1.500 0.000
diabetes mellitus -1.500 0.002
Breast cancer 3.700 0.033
interstitial cystitis -1.600 0.003
pancreatic carcinoma 1.100 0.001
ovarian cancer -2.000 0.000
pituitary cancer 2.400 0.000

Synonym

Accession Q9ULJ7 A8K4V3 B4DHJ6 E9PDW0 Q6N064 Q6ZSE6
Symbols

Gene

  Ortholog (13)

AA Sequence

MTNPWEEKVCKMAQTSLLQGKQFYCREWVFHKLQHCLQEKSNCCNSAVNAPSLVMNSGNNASGVSGKGAA      1 - 70
WGVLLVGGPGSGKTALCTELLWPSSPASLQRGLHRQALAFHFCKAQDSDTLCVGGFIRGLVAQICRSGLL     71 - 140
QGYEDKLRDPAVQSLLQPGECERNPAEAFKRCVLLPLLGMKPPQQSLYLLVDSVDEGCNITEGEQTSTSL    141 - 210
SGTVAALLAGHHEFFPPWLLLLCSARKQSKAVTKMFTGFRKISLDDLRKAYIVKDVQQYILHRLDQEEAL    211 - 280
RQHLTKETAEMLNQLHIKSSGCFLYLERVLDGVVENFIMLREIRDIPGTLNGLYLWLCQRLFVRKQFAKV    281 - 350
QPILNVILAACRPLTITELYHAVWTKNMSLTLEDFQRKLDILSKLLVDGLGNTKILFHYSFAEWLLDVKH    351 - 420
CTQKYLCNAAEGHRMLAMSYTCQAKNLTPLEAQEFALHLINSNLQLETAELALWMIWNGTPVRDSLSTLI    421 - 490
PKEQEVLQLLVKAGAHVNSEDDRTSCIVRQALEREDSIRTLLDNGASVNQCDSNGRTLLANAAYSGSLDV    491 - 560
VNLLVSRGADLEIEDAHGHTPLTLAARQGHTKVVNCLIGCGANINHTDQDGWTALRSAAWGGHTEVVSAL    561 - 630
LYAGVKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHG    631 - 700
AEVNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEG    701 - 770
GADVDHTDNNGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDE    771 - 840
NHRDDAGWTPLHMAAFEGHRLICEALIEQGARTNEIDNDGRIPFILASQEGHYDCVQILLENKSNIDQRG    841 - 910
YDGRNALRVAALEGHRDIVELLFSHGADVNCKDADGRPTLYILALENQLTMAEYFLENGANVEASDAEGR    911 - 980
TALHVSCWQGHMEMVQVLIAYHADVNAADNEKRSALQSAAWQGHVKVVQLLIEHGAVVDHTCNQGATALC    981 - 1050
IAAQEGHIDVVQVLLEHGADPNHADQFGRTAMRVAAKNGHSQIIKLLEKYGASSLNGCSPSPVHTMEQKP   1051 - 1120
LQSLSSKVQSLTIKSNSSGSTGGGDMQPSLRGLPNGPTHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNS   1121 - 1190
SLRTTSSTATAQTVPIDSFHNLSFTEQIQQHSLPRSRSRQSIVSPSSTTQSLGQSHNSPSSEFEWSQVKP   1191 - 1260
SLKSTKASKGGKSENSAKSGSAGKKAKQSNSSQPKVLEYEMTQFDRRGPIAKSGTAAPPKQMPAESQCKI   1261 - 1330
MIPSAQQEIGRSQQQFLIHQQSGEQKKRNGIMTNPNYHLQSNQVFLGRVSVPRTMQDRGHQEVLEGYPSS   1331 - 1400
ETELSLKQALKLQIEGSDPSFNYKKETPL                                            1401 - 1429
//

Text Mined References (11)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25278552 2014 Identification of molecular heterogeneity in SNX27-retromer-mediated endosome-to-plasma-membrane recycling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21911577 2011 A physical interaction network of dengue virus and human proteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...