Property Summary

NCBI Gene PubMed Count 48
Grant Count 6
R01 Count 6
Funding $419,529.53
PubMed Score 34.49
PubTator Score 14.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
oligodendroglioma 1.400 0.003
osteosarcoma -1.457 0.009
chronic lymphosyte leukemia -1.800 0.000
astrocytoma 1.900 0.000
autosomal dominant Emery-Dreifuss muscul... 1.149 0.006
acute quadriplegic myopathy 1.053 0.001
tuberculosis -1.300 0.000
primary pancreatic ductal adenocarcinoma 1.275 0.014
lung cancer -1.200 0.006
acute myeloid leukemia 1.100 0.001
pancreatic cancer 1.100 0.006

Synonym

Accession Q9ULJ6 Q5JSH9 Q7Z7E6
Symbols MIZ
RAI17
ZIMP10
hZIMP10
TRAFIP10

Gene

PANTHER Protein Class (1)

PDB

5AIZ  

 GO Function (1)

Gene RIF (18)

PMID Text
26624892 At the ZMIZ1 locus, we show that perturbation of ZMIZ1 expression in human islets and beta-cells influences exocytosis and insulin secretion, highlighting a novel role for ZMIZ1 in the maintenance of glucose homeostasis.
26522984 Targeting the NOTCH1-ZMIZ1 interaction might combat leukemic growth.
26403403 the expression of SENP8, SAE1, PIAS1, PIAS2 and ZMIZ1 is deregulated in the majority of PTC tissues, likely contributing to the PTC phenotype.
26163108 This case represents the first constitutional balanced translocation disrupting and fusing both MIZ-type containing and proline-rich 12 and provides clues for the potential function and effects of these in the central nervous system.
24667117 ZMIZ1 is a susceptibility gene for vitiligo in Chinese population.
23426136 ZMIZ1 is overexpressed in a significant percentage of human breast, ovarian, and colon cancers in addition to human squamous cell carcinomas, suggesting that ZMIZ1 may play a broader role in epithelial cancers.
23161489 ZMIZ1 and activated NOTCH1 are coexpressed in a subset of human T-ALL patients and cell lines.
20473688 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19929986 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFD      1 - 70
LDLGYRLLAVCAANRDKFTPKSAALLSSWCEELGRLLLLRHQKSRQSDPPGKLPMQPPLSSMSSMKPTLS     71 - 140
HSDGSFPYDSVPWQQNTNQPPGSLSVVTTVWGVTNTSQSQVLGNPMANANNPMNPGGNPMASGMTTSNPG    141 - 210
LNSPQFAGQQQQFSAKAGPAQPYIQQSMYGRPNYPGSGGFGASYPGGPNAPAGMGIPPHTRPPADFTQPA    211 - 280
AAAAAAAVAAAAATATATATATVAALQETQNKDINQYGPMGPTQAYNSQFMNQPGPRGPASMGGSMNPAS    281 - 350
MAAGMTPSGMSGPPMGMNQPRPPGISPFGTHGQRMPQQTYPGPRPQSLPIQNIKRPYPGEPNYGNQQYGP    351 - 420
NSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNY    421 - 490
SQGNVNRPPRPVPVANYPHSPVPGNPTPPMTPGSSIPPYLSPSQDVKPPFPPDIKPNMSALPPPPANHND    491 - 560
ELRLTFPVRDGVVLEPFRLEHNLAVSNHVFHLRPTVHQTLMWRSDLELQFKCYHHEDRQMNTNWPASVQV    561 - 630
SVNATPLTIERGDNKTSHKPLHLKHVCQPGRNTIQITVTACCCSHLFVLQLVHRPSVRSVLQGLLKKRLL    631 - 700
PAEHCITKIKRNFSSVAASSGNTTLNGEDGVEQTAIKVSLKCPITFRRIQLPARGHDCKHVQCFDLESYL    701 - 770
QLNCERGTWRCPVCNKTALLEGLEVDQYMWGILNAIQHSEFEEVTIDPTCSWRPVPIKSDLHIKDDPDGI    771 - 840
PSKRFKTMSPSQMIMPNVMEMIAALGPGPSPYPLPPPPGGTNSNDYSSQGNNYQGHGNFDFPHGNPGGTS    841 - 910
MNDFMHGPPQLSHPPDMPNNMAALEKPLSHPMQETMPHAGSSDQPHPSIQQGLHVPHPSSQSGPPLHHSG    911 - 980
APPPPPSQPPRQPPQAAPSSHPHSDLTFNPSSALEGQAGAQGASDMPEPSLDLLPELTNPDELLSYLDPP    981 - 1050
DLPSNSNDDLLSLFENN                                                        1051 - 1067
//

Text Mined References (53)

PMID Year Title
26624892 2015 Transcript Expression Data from Human Islets Links Regulatory Signals from Genome-Wide Association Studies for Type 2 Diabetes and Glycemic Traits to Their Downstream Effectors.
26522984 2015 The PIAS-like Coactivator Zmiz1 Is a Direct and Selective Cofactor of Notch1 in T Cell Development and Leukemia.
26403403 PAPILLARY THYROID CANCER IS CHARACTERIZED BY ALTERED EXPRESSION OF GENES INVOLVED IN THE SUMOYLATION PROCESS.
26163108 2015 A de novo t(10;19)(q22.3;q13.33) leads to ZMIZ1/PRR12 reciprocal fusion transcripts in a girl with intellectual disability and neuropsychiatric alterations.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
More...