Property Summary

NCBI Gene PubMed Count 50
PubMed Score 37.88
PubTator Score 14.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia 1.100 1.2e-03
acute quadriplegic myopathy 1.053 7.0e-04
astrocytoma 1.900 8.2e-05
autosomal dominant Emery-Dreifuss muscul... 1.149 5.6e-03
chronic lymphosyte leukemia -1.800 4.7e-13
lung cancer -1.200 6.0e-03
oligodendroglioma 1.400 3.1e-03
osteosarcoma -1.457 8.8e-03
pancreatic cancer 1.100 5.7e-03
primary pancreatic ductal adenocarcinoma 1.275 1.4e-02
tuberculosis -1.300 2.6e-05

 GO Function (1)

Gene RIF (20)

AA Sequence

MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFD      1 - 70
LDLGYRLLAVCAANRDKFTPKSAALLSSWCEELGRLLLLRHQKSRQSDPPGKLPMQPPLSSMSSMKPTLS     71 - 140
HSDGSFPYDSVPWQQNTNQPPGSLSVVTTVWGVTNTSQSQVLGNPMANANNPMNPGGNPMASGMTTSNPG    141 - 210
LNSPQFAGQQQQFSAKAGPAQPYIQQSMYGRPNYPGSGGFGASYPGGPNAPAGMGIPPHTRPPADFTQPA    211 - 280
AAAAAAAVAAAAATATATATATVAALQETQNKDINQYGPMGPTQAYNSQFMNQPGPRGPASMGGSMNPAS    281 - 350
MAAGMTPSGMSGPPMGMNQPRPPGISPFGTHGQRMPQQTYPGPRPQSLPIQNIKRPYPGEPNYGNQQYGP    351 - 420
NSQFPTQPGQYPAPNPPRPLTSPNYPGQRMPSQPSSGQYPPPTVNMGQYYKPEQFNGQNNTFSGSSYSNY    421 - 490
SQGNVNRPPRPVPVANYPHSPVPGNPTPPMTPGSSIPPYLSPSQDVKPPFPPDIKPNMSALPPPPANHND    491 - 560
ELRLTFPVRDGVVLEPFRLEHNLAVSNHVFHLRPTVHQTLMWRSDLELQFKCYHHEDRQMNTNWPASVQV    561 - 630
SVNATPLTIERGDNKTSHKPLHLKHVCQPGRNTIQITVTACCCSHLFVLQLVHRPSVRSVLQGLLKKRLL    631 - 700
PAEHCITKIKRNFSSVAASSGNTTLNGEDGVEQTAIKVSLKCPITFRRIQLPARGHDCKHVQCFDLESYL    701 - 770
QLNCERGTWRCPVCNKTALLEGLEVDQYMWGILNAIQHSEFEEVTIDPTCSWRPVPIKSDLHIKDDPDGI    771 - 840
PSKRFKTMSPSQMIMPNVMEMIAALGPGPSPYPLPPPPGGTNSNDYSSQGNNYQGHGNFDFPHGNPGGTS    841 - 910
MNDFMHGPPQLSHPPDMPNNMAALEKPLSHPMQETMPHAGSSDQPHPSIQQGLHVPHPSSQSGPPLHHSG    911 - 980
APPPPPSQPPRQPPQAAPSSHPHSDLTFNPSSALEGQAGAQGASDMPEPSLDLLPELTNPDELLSYLDPP    981 - 1050
DLPSNSNDDLLSLFENN                                                        1051 - 1067
//

Text Mined References (56)

PMID Year Title