Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease 1.109 1.2e-02
cystic fibrosis 1.189 1.0e-03
gastric carcinoma 1.400 1.2e-02
medulloblastoma, large-cell -1.500 2.4e-05
osteosarcoma -1.690 4.7e-03
posterior fossa group B ependymoma 1.400 1.0e-04

Synonym

Accession Q9ULJ1 A8MU56 B4E037 Q05C40 Q5BJG5 Q5TBX3 Q5TBX4 Q86X31
Symbols dJ977L11.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MEKAVNDGSHSEELFCHLKTISEKEDLPRCTSESHLSCLKQDILNEKTELEATLKEAELVTHSVELLLPL      1 - 70
FKDTIEKINFENANLSALNLKISEQKEILIKELDTFKSVKLALEHLLRKRDYKQTGDNLSSMLLENLTDN     71 - 140
ESENTNLKKKVFEKEAHIQELSCLFQSEKANTLKANRFSQSVKVVHERLQIQIHKREAENDKLKEYVKSL    141 - 210
ETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISA    211 - 280
SNAWKSHYEKIVIEKTELEVQIETMKKQIINLLEDLKKMEDHGKNSCEEILRKVHSIEYENETLNLENTK    281 - 350
LKLRFPCRITESKNMNILIVLDMLCYISSEKTTLAALKDEVVSVENELSELQEVEKKQKTLIEMYKTQVQ    351 - 420
KLQEAAEIVKSRCENLLHKNNQITKTKNKNVEKMRGQMESHLKELERVCDSLTAAERRLHECQESLQCCK    421 - 490
GKCADQEHTIRELQGQVDGNHNLLTKLSLEEENCLIQLKCENLQQKLEQMDAENKELEKKLANQEECLKH    491 - 560
SNLKFKEKSAEYTALARQLEAALEEGRQKVAEEIEKMSSRESALQIKILDLETELRKKNEEQNQLVCKMN    561 - 630
SDPETP                                                                    631 - 636
//

Text Mined References (7)

PMID Year Title