Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 2.44223798906253E-5
posterior fossa group B ependymoma 1530 1.04893471489351E-4
cystic fibrosis 1670 0.00104871810179347
osteosarcoma 7933 0.00466278747202287
active Crohn's disease 918 0.0117331681859498
gastric carcinoma 832 0.0124551158650481

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.690 0.005
cystic fibrosis 1.189 0.001
medulloblastoma, large-cell -1.500 0.000
active Crohn's disease 1.109 0.012
posterior fossa group B ependymoma 1.400 0.000
gastric carcinoma 1.400 0.012

Synonym

Accession Q9ULJ1 A8MU56 B4E037 Q05C40 Q5BJG5 Q5TBX3 Q5TBX4 Q86X31
Symbols dJ977L11.1

Gene

  Ortholog (10)

AA Sequence

MEKAVNDGSHSEELFCHLKTISEKEDLPRCTSESHLSCLKQDILNEKTELEATLKEAELVTHSVELLLPL      1 - 70
FKDTIEKINFENANLSALNLKISEQKEILIKELDTFKSVKLALEHLLRKRDYKQTGDNLSSMLLENLTDN     71 - 140
ESENTNLKKKVFEKEAHIQELSCLFQSEKANTLKANRFSQSVKVVHERLQIQIHKREAENDKLKEYVKSL    141 - 210
ETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISA    211 - 280
SNAWKSHYEKIVIEKTELEVQIETMKKQIINLLEDLKKMEDHGKNSCEEILRKVHSIEYENETLNLENTK    281 - 350
LKLRFPCRITESKNMNILIVLDMLCYISSEKTTLAALKDEVVSVENELSELQEVEKKQKTLIEMYKTQVQ    351 - 420
KLQEAAEIVKSRCENLLHKNNQITKTKNKNVEKMRGQMESHLKELERVCDSLTAAERRLHECQESLQCCK    421 - 490
GKCADQEHTIRELQGQVDGNHNLLTKLSLEEENCLIQLKCENLQQKLEQMDAENKELEKKLANQEECLKH    491 - 560
SNLKFKEKSAEYTALARQLEAALEEGRQKVAEEIEKMSSRESALQIKILDLETELRKKNEEQNQLVCKMN    561 - 630
SDPETP                                                                    631 - 636
//

Text Mined References (7)

PMID Year Title
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.