Property Summary

NCBI Gene PubMed Count 11
PubMed Score 129.26
PubTator Score 2.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma 1.100 2.3e-03
cystic fibrosis 1.300 1.3e-02
ependymoma 1.100 4.0e-02
gastric carcinoma 1.200 2.7e-02
glioblastoma 1.200 1.6e-04
group 4 medulloblastoma -1.500 3.3e-04
interstitial cystitis 1.400 4.1e-04
intraductal papillary-mucinous adenoma (... -1.700 1.1e-06
intraductal papillary-mucinous carcinoma... -1.800 2.6e-07
intraductal papillary-mucinous neoplasm ... -1.800 7.6e-05
juvenile dermatomyositis 1.226 3.0e-10
lung adenocarcinoma -1.900 2.7e-15
lung cancer -2.200 1.5e-04
lung carcinoma -2.300 9.6e-19
non-small cell lung cancer -1.096 4.2e-10
ovarian cancer -2.600 4.5e-12
primary pancreatic ductal adenocarcinoma 1.417 2.7e-02
primary Sjogren syndrome 1.500 2.0e-04
ulcerative colitis 2.100 5.7e-07
urothelial carcinoma 1.300 4.0e-02

Gene RIF (5)

AA Sequence

MASPRASRWPPPLLLLLLPLLLLPPAAPGTRDPPPSPARRALSLAPLAGAGLELQLERRPEREPPPTPPR      1 - 70
ERRGPATPGPSYRAPEPGAATQRGPSGRAPRGGSADAAWKHWPESNTEAHVENITFYQNQEDFSTVSSKE     71 - 140
GVMVQTSGKSHAASDAPENLTLLAETADARGRSGSSSRTNFTILPVGYSLEIATALTSQSGNLASESLHL    141 - 210
PSSSSEFDERIAAFQTKSGTASEMGTERAMGLSEEWTVHSQEATTSAWSPSFLPALEMGELTTPSRKRNS    211 - 280
SGPDLSWLHFYRTAASSPLLDLSSSSESTEKLNNSTGLQSSSVSQTKTMHVATVFTDGGPRTLRSLTVSL    281 - 350
GPVSKTEGFPKDSRIATTSSSVLLSPSAVESRRNSRVTGNPGDEEFIEPSTENEFGLTSLRWQNDSPTFG    351 - 420
EHQLASSSEVQNGSPMSQTETVSRSVAPMRGGEITAHWLLTNSTTSADVTGSSASYPEGVNASVLTQFSD    421 - 490
STVQSGGSHTALGDRSYSESSSTSSSESLNSSAPRGERSIAGISYGQVRGTAIEQRTSSDHTDHTYLSST    491 - 560
FTKGERALLSITDNSSSSDIVESSTSYIKISNSSHSEYSSFFHAQTERSNISSYDGEYAQPSTESPVLHT    561 - 630
SNLPSYTPTINMPNTSVVLDTDAEFVSDSSSSSSSSSSSSSSGPPLPLPSVSQSHHLFSSILPSTRASVH    631 - 700
LLKSTSDASTPWSSSPSPLPVSLTTSTSAPLSVSQTTLPQSSSTPVLPRARETPVTSFQTSTMTSFMTML    701 - 770
HSSQTADLKSQSTPHQEKVITESKSPSLVSLPTESTKAVTTNSPLPPSLTESSTEQTLPATSTNLAQMSP    771 - 840
TFTTTILKTSQPLMTTPGTLSSTASLVTGPIAVQTTAGKQLSLTHPEILVPQISTEGGISTERNRVIVDA    841 - 910
TTGLIPLTSVPTSAKEMTTKLGVTAEYSPASRSLGTSPSPQTTVVSTAEDLAPKSATFAVQSSTQSPTTV    911 - 980
SSSASVNSCAVNPCLHNGECVADNTSRGYHCRCPPSWQGDDCSVDVNECLSNPCPSTAMCNNTQGSFICK    981 - 1050
CPVGYQLEKGICNLVRTFVTEFKLKRTFLNTTVEKHSDLQEVENEITKTLNMCFSALPSYIRSTVHASRE   1051 - 1120
SNAVVISLQTTFSLASNVTLFDLADRMQKCVNSCKSSAEVCQLLGSQRRIFRAGSLCKRKSPECDKDTSI   1121 - 1190
CTDLDGVALCQCKSGYFQFNKMDHSCRACEDGYRLENETCMSCPFGLGGLNCGNPYQLITVVIAAAGGGL   1191 - 1260
LLILGIALIVTCCRKNKNDISKLIFKSGDFQMSPYAEYPKNPRSQEWGREAIEMHENGSTKNLLQMTDVY   1261 - 1330
YSPTSVRNPELERNGLYPAYTGLPGSRHSCIFPGQYNPSFISDESRRRDYF                      1331 - 1381
//

Text Mined References (17)

PMID Year Title