Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.63
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
oligodendroglioma 2849 1.29303289868285E-14
juvenile dermatomyositis 1189 1.70228014809902E-10
osteosarcoma 7933 1.70364329777568E-5
primitive neuroectodermal tumor 3031 9.8255604113628E-5
ovarian cancer 8492 1.84944572761764E-4
Pick disease 1893 2.48744508278973E-4
medulloblastoma, large-cell 6234 0.00151419996143906
sonic hedgehog group medulloblastoma 1482 0.00152014963496162
pituitary cancer 1972 0.00195120587718398
ependymoma 2514 0.00199340225197757
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00353102763362126
invasive ductal carcinoma 2950 0.00433899489932211
chronic rhinosinusitis 512 0.00539557439229109
astrocytic glioma 2241 0.0144095522937866
atypical teratoid / rhabdoid tumor 4369 0.0204502161378032
progressive supranuclear palsy 674 0.0268114422345482
Endometriosis 535 0.0364045158172874

Expression

  Differential Expression (17)

Synonym

Accession Q9ULI2 B7Z834 D3DUV2 Q8N4P4 Q8WTW6
Symbols NAAGS
FAM80B
NAAGS-I

Gene

  Ortholog (9)

Gene RIF (1)

PMID Text
21454531 ribosomal modification protein rimK-like family member A (Rimkla) gene is a NAAG synthetase (NAAGS-II), which synthesizes the N-acetylated tripeptide N-acetylaspartylglutamylglutamate (NAAG(2))

AA Sequence

MCSSVAAKLWFLTDRRIREDYPQKEILRALKAKCCEEELDFRAVVMDEVVLTIEQGNLGLRINGELITAY      1 - 70
PQVVVVRVPTPWVQSDSDITVLRHLEKMGCRLMNRPQAILNCVNKFWTFQELAGHGVPLPDTFSYGGHEN     71 - 140
FAKMIDEAEVLEFPMVVKNTRGHRGKAVFLARDKHHLADLSHLIRHEAPYLFQKYVKESHGRDVRVIVVG    141 - 210
GRVVGTMLRCSTDGRMQSNCSLGGVGMMCSLSEQGKQLAIQVSNILGMDVCGIDLLMKDDGSFCVCEANA    211 - 280
NVGFIAFDKACNLDVAGIIADYAASLLPSGRLTRRMSLLSVVSTASETSEPELGPPASTAVDNMSASSSS    281 - 350
VDSDPESTERELLTKLPGGLFNMNQLLANEIKLLVD                                      351 - 386
//

Text Mined References (7)

PMID Year Title
21454531 2011 N-acetylaspartylglutamate synthetase II synthesizes N-acetylaspartylglutamylglutamate.
20643647 2010 Molecular characterization of N-acetylaspartylglutamate synthetase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.