Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.63
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.800 1.4e-02
atypical teratoid / rhabdoid tumor 1.100 2.0e-02
chronic rhinosinusitis -1.132 5.4e-03
Endometriosis -1.014 3.6e-02
ependymoma 2.500 2.0e-03
intraductal papillary-mucinous carcinoma... -1.400 3.5e-03
invasive ductal carcinoma -1.200 4.3e-03
juvenile dermatomyositis 1.115 1.7e-10
medulloblastoma 1.100 5.3e-03
medulloblastoma, large-cell -1.400 1.8e-02
oligodendroglioma 1.100 3.7e-02
osteosarcoma -1.784 4.0e-04
ovarian cancer -1.500 1.8e-04
Pick disease -1.200 3.8e-05
pituitary cancer 1.100 2.0e-03
primitive neuroectodermal tumor 1.500 9.8e-05
progressive supranuclear palsy -1.100 2.7e-02

Gene RIF (1)

AA Sequence

MCSSVAAKLWFLTDRRIREDYPQKEILRALKAKCCEEELDFRAVVMDEVVLTIEQGNLGLRINGELITAY      1 - 70
PQVVVVRVPTPWVQSDSDITVLRHLEKMGCRLMNRPQAILNCVNKFWTFQELAGHGVPLPDTFSYGGHEN     71 - 140
FAKMIDEAEVLEFPMVVKNTRGHRGKAVFLARDKHHLADLSHLIRHEAPYLFQKYVKESHGRDVRVIVVG    141 - 210
GRVVGTMLRCSTDGRMQSNCSLGGVGMMCSLSEQGKQLAIQVSNILGMDVCGIDLLMKDDGSFCVCEANA    211 - 280
NVGFIAFDKACNLDVAGIIADYAASLLPSGRLTRRMSLLSVVSTASETSEPELGPPASTAVDNMSASSSS    281 - 350
VDSDPESTERELLTKLPGGLFNMNQLLANEIKLLVD                                      351 - 386
//

Text Mined References (7)

PMID Year Title