Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.63
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (1)

PMID Text
21454531 ribosomal modification protein rimK-like family member A (Rimkla) gene is a NAAG synthetase (NAAGS-II), which synthesizes the N-acetylated tripeptide N-acetylaspartylglutamylglutamate (NAAG(2))

AA Sequence

MCSSVAAKLWFLTDRRIREDYPQKEILRALKAKCCEEELDFRAVVMDEVVLTIEQGNLGLRINGELITAY      1 - 70
PQVVVVRVPTPWVQSDSDITVLRHLEKMGCRLMNRPQAILNCVNKFWTFQELAGHGVPLPDTFSYGGHEN     71 - 140
FAKMIDEAEVLEFPMVVKNTRGHRGKAVFLARDKHHLADLSHLIRHEAPYLFQKYVKESHGRDVRVIVVG    141 - 210
GRVVGTMLRCSTDGRMQSNCSLGGVGMMCSLSEQGKQLAIQVSNILGMDVCGIDLLMKDDGSFCVCEANA    211 - 280
NVGFIAFDKACNLDVAGIIADYAASLLPSGRLTRRMSLLSVVSTASETSEPELGPPASTAVDNMSASSSS    281 - 350
VDSDPESTERELLTKLPGGLFNMNQLLANEIKLLVD                                      351 - 386
//

Publication (7)

PMID Year Title
21454531 2011 N-acetylaspartylglutamate synthetase II synthesizes N-acetylaspartylglutamylglutamate.
20643647 2010 Molecular characterization of N-acetylaspartylglutamate synthetase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.