Property Summary

NCBI Gene PubMed Count 3
Grant Count 5
R01 Count 5
Funding $278,705
PubMed Score 6.31
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MWPAGAGTKLPCPRDSALRRAAFSGNLTALPSHLVPAGRSVRVFISANPEDTGAERQALRENVYPKLREF      1 - 70
CRENYGLEFQVIDLYWGVEEDEWDSPELQKTRMKLLENCLKTSAGPCFVGLLGEKYGNIRIPGEVEASEF     71 - 140
EMILDAAIEAKLETKLLEEWYCRDENSVPAAYYLRPKSEMLRSNRNAMQPSTNAENEKTWQEISDEIKKI    141 - 210
FKAAVKLLHEKGKMKHSQAKRYLFSAIEDEFDFALGKQTPAFLKKCVCYIRKIANIERFVKIPEMGKYMD    211 - 280
ITGTEPRIIRDPEAQEKLIKLRDEFIPTIVASSNLRVYTSVTHCDMKLGYSQEIENHYIEGLGKQFYEDM    281 - 350
IDIIQATIQQNFDTETDTLYDEILQHSSLCKTYASFYEYKCESLNIVHNYILPSKAGHINPLIIYGGPCT    351 - 420
GKTLLLAEVAKKAYGWLHEDTGPESDPVVIVRFLGTTDMSSDLRTLLLSVCEQLAVNYRCLVQSYPKKIH    421 - 490
DLCDLFINLLNESSLQRPLVIIFDALEQLSENDDARKLWWLPAHLPRFVRIVLSTLPNKHGILQKLRCLI    491 - 560
HEEDNYIELIPRDRKMCSQVLKHQLLRVKRKVTSGQQIYVNNALSKCTLPMFVNLTFREVRHWRSHKDVD    561 - 630
ESSLSVTVHESIEQLFWSLEKKCGQKLVSRALGYITMAKMGLSEMELEDVLALDNSVMSELKENTRPSNP    631 - 700
LRVPYLYIARLKEGLSGYLIERHVKNVTLLVWANRHLQLIAQKLYLQDDNDLREMHTILADYFLGVWSGG    701 - 770
RRKAFCLEDPYLNGCLDLENRSLLEEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIFFVNHRKMSELLYH    771 - 840
LTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKELKFLANTLRSIKNKVTAFPGSL    841 - 910
SAELQQRLLPVVSSLPKLRHLLLECDKDGPKYCSIVPLHSSMDVTYSPERLPLSSSHLHVTEILPTCNPS    911 - 980
TVLTALENGSISTWDVETRQLLRQITTAQSVILGMKLTSDEKYLVVATTNNTLLIYDNVNSCLLSEVEIK    981 - 1050
GTKHGSSATYINGFTLSANHALAWLEASKDVTVIDLLYGWPLYQFHCWYEVTCVQCSLDGLYAFCGQYLN   1051 - 1120
TTTIFHLGSGEKLCTVTSEFSGGFVKFLLILDTAQEMVMVDSEGSLSVWNTEDISSPQLTDDFDCRREDS   1121 - 1190
EVVSIELSEDQSAVLICKALSIELLDTGLWKVAEKFRAKHNERFISAVLSKNGDCIIATMENTSAVFFWR   1191 - 1260
RDTGQCMASLQEISGSIVKLVKSSHHNMLLSLSTSGVLSIWDIDIITAMSNIDKTGKPIQSLLLPARGEI   1261 - 1330
IYSLDGSDCVHKWNFSSGFIEAVFKHEGIVEHCVLTSTGDIMVTSDDKSSQYVWHTSSGENLFRINGQRI   1331 - 1400
SQLLITHNDQFVVSLCEENASRVWRLATGHRVCNILTTLQNAFITSANTFVVGMTKSKVLAVSLWTGSIT   1401 - 1470
KKFCCEDGTTIVNFKLIPDCPDIIVFITSAETVNIWSLTDEVICRRVQLPNNFLKNLEDFEISPNGKLGI   1471 - 1540
IARGDENINVLDLYSGKLRVVHASGIIWRQRLSRDGRYLVYICFRNGEEEDENGAIFSLIVMRLADGKNI   1541 - 1610
GACSLYKTPTFLALSQRHLNIIVGFDDGSIGIYTVVDRVDAALKIKIATSNSRQIFNNATHTSRPKCNSY   1611 - 1680
CFKISVDCLWRESTEVFARDSPITVSDSTESNEATPSKKHNSCYERVCSALEARGHSYAPDN           1681 - 1742
//

Publication (5)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9847074 1998 Toward a complete human genome sequence.