Property Summary

NCBI Gene PubMed Count 29
PubMed Score 16.40
PubTator Score 17.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
chronic lymphocytic leukemia 1.143 7.4e-03
astrocytoma -2.300 2.4e-02
ependymoma -2.100 4.0e-03
oligodendroglioma -1.700 5.4e-21
glioblastoma -2.000 2.4e-04
osteosarcoma -1.344 6.6e-06
atypical teratoid / rhabdoid tumor -1.500 1.0e-03
medulloblastoma -1.800 5.8e-05
medulloblastoma, large-cell -2.700 1.2e-03
primitive neuroectodermal tumor -1.600 3.6e-03
Breast cancer -3.200 2.4e-02
lung adenocarcinoma -1.200 4.1e-09
lung carcinoma 1.100 3.4e-14
dermatomyositis 1.200 5.8e-04

Pathway (1)

Gene RIF (14)

PMID Text
26498848 Study showed that MRTF-A and MRTF-B were upregulated in pancreatic cancer tissues supporting the hypothesis that both of them are oncogenes in pancreatic cancer.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that MKL2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with MKL2
24968937 There were multiple independent HIV integrations in several genes, including MKL2 and BACH2; many of these integrations were in clonally expanded cells.
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that MKL2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with MKL2
23853104 MKL1/2 depletion resulted in Ras activation, elevated p16 expression and hypophosphorylation of the retinoblastoma (Rb) protein in DLC1-deficient hepatocellular carcinoma cells.
23692340 While disruption of the MKL2:SRF axis has been associated with severe microcephaly and disordered brain development in multiple model systems, the role of this transcription factor complex has not been previously demonstrated in human brain development.
23672313 Based on a recurrent translocation t(11;16)(q13;p13), the C11orf95-MKL2 fusion gene has been found in eight further cases of chondroid lipomas.
22139079 study provides evidence that MKL1/2 mediates cancerous transformation in DLC1-deficient hepatocellular and mammary carcinoma cells
20607705 C11orf95-MKL2 is the resulting fusion oncogene of t(11;16)(q13;p13) in chondroid lipoma.
20442744 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19198601 RNA interference was used to investigate the contribution of the MRTF-SRF pathway to cytoskeletal dynamics in MDA-MB-231 breast carcinoma and B16F2 melanoma cells, in which basal MRTF-SRF activity is Rho-dependent.
18056415 Myocardin-related transcription factors are critical mediators of transforming growth factor beta (TGF-beta) 1-induced epithelial-mesenchymal transition.[
17947237 BMP signaling modulates VSMC phenotype via cross-talk with the RhoA/MRTFs pathway, and may contribute to the development of the pathological characteristics observed in patients with PAH and other obliterative vascular diseases.
14565952 dominant negative MKL2 blocked differentiation-induced expression of SRF target genes skeletal alpha-actin and alpha-myosin heavy chain and blocked differentiation of the myoblasts to myotubes in vitro.

AA Sequence

MIDSSKKQQQGFPEILTAGDFEPLKEKECLEGSNQKSLKEVLQLRLQQRRTREQLVDQGIMPPLKSPAAF      1 - 70
HEQIKSLERARTENFLKHKIRSRPDRSELVRMHILEETFAEPSLQATQMKLKRARLADDLNEKIAQRPGP     71 - 140
MELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESP    141 - 210
SPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNPNDKHRSK    211 - 280
KCKDPKPRVKKLKYHQYIPPDQKGEKNEPQMDSNYARLLQQQQLFLQLQILSQQKQHYNYQTILPAPFKP    281 - 350
LNDKNSNSGNSALNNATPNTPRQNTSTPVRKPGPLPSSLDDLKVSELKTELKLRGLPVSGTKPDLIERLK    351 - 420
PYQEVNSSGLAAGGIVAVSSSAIVTSNPEVTVALPVTTLHNTVTSSVSTLKAELPPTGTSNATRVENVHS    421 - 490
PLPISPSPSEQSSLSTDDTNMADTFTEIMTMMSPSQFLSSSPLRMTNNEDSLSPTSSTLSNLELDAAEKD    491 - 560
RKLQEKEKQIEELKRKLEQEQKLVEVLKMQLEVEKRGQQQRPLEAQPSAPGHSVKSDQKHGSLGSSIKDE    561 - 630
ASLPDCSSSRQPIPVASHAVGQPVSTGGQTLVAKKAVVIKQEVPVGQAEQQSVVSQFYVSSQGQPPPAVV    631 - 700
AQPQALLTTQTAQLLLPVSIQGSSVTSVQLPVGSLKLQTSPQAGMQTQPQIATAAQIPTAALASGLAPTV    701 - 770
PQTQDTFPQHVLSQPQQVRKVFTNSASSNTVLPYQRHPAPAVQQPFINKASNSVLQSRNAPLPSLQNGPN    771 - 840
TPNKPSSPPPPQQFVVQHSLFGSPVAKTKDPPRYEEAIKQTRSTQAPLPEISNAHSQQMDDLFDILIKSG    841 - 910
EISLPIKEEPSPISKMRPVTASITTMPVNTVVSRPPPQVQMAPPVSLEPMGSLSASLENQLEAFLDGTLP    911 - 980
SANEIPPLQSSSEDREPFSLIEDLQNDLLSHSGMLDHSHSPMETSETQFAAGTPCLSLDLSDSNLDNMEW    981 - 1050
LDITMPNSSSGLTPLSTTAPSMFSADFLDPQDLPLPWD                                   1051 - 1088
//

Text Mined References (39)

PMID Year Title
26498848 2016 The MRTF-A/B function as oncogenes in pancreatic cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24968937 2014 HIV latency. Specific HIV integration sites are linked to clonal expansion and persistence of infected cells.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24770850 2014 Genome-wide association study of sexual maturation in males and females highlights a role for body mass and menarche loci in male puberty.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23853104 2013 Depletion of the transcriptional coactivators megakaryoblastic leukaemia 1 and 2 abolishes hepatocellular carcinoma xenograft growth by inducing oncogene-induced senescence.
23692340 2014 Genetic variation in MKL2 and decreased downstream PCTAIRE1 expression in extreme, fatal primary human microcephaly.
23672313 2013 Presence of C11orf95-MKL2 fusion is a consistent finding in chondroid lipomas: a study of eight cases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22139079 2012 The transcriptional coactivators megakaryoblastic leukemia 1/2 mediate the effects of loss of the tumor suppressor deleted in liver cancer 1.
21269460 2011 Initial characterization of the human central proteome.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20607705 2010 C11orf95-MKL2 is the resulting fusion oncogene of t(11;16)(q13;p13) in chondroid lipoma.
20442744 2010 Linkage and candidate gene studies of autism spectrum disorders in European populations.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19198601 2009 Myocardin-related transcription factors and SRF are required for cytoskeletal dynamics and experimental metastasis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18056415 2007 Dual roles of myocardin-related transcription factors in epithelial mesenchymal transition via slug induction and actin remodeling.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17947237 2007 Control of phenotypic plasticity of smooth muscle cells by bone morphogenetic protein signaling through the myocardin-related transcription factors.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14565952 2003 Megakaryoblastic leukemia-1/2, a transcriptional co-activator of serum response factor, is required for skeletal myogenic differentiation.
12944485 2003 Megakaryoblastic leukemia 1, a potent transcriptional coactivator for serum response factor (SRF), is required for serum induction of SRF target genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397177 2002 Potentiation of serum response factor activity by a family of myocardin-related transcription factors.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.