Property Summary

NCBI Gene PubMed Count 29
PubMed Score 19.05
PubTator Score 17.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.000 2.0e-03
atypical teratoid / rhabdoid tumor -1.500 1.0e-03
Breast cancer -2.200 2.7e-02
Chronic Lymphocytic Leukemia 1.143 7.4e-03
dermatomyositis 1.200 5.8e-04
ependymoma -2.100 4.0e-03
glioblastoma -2.000 2.4e-04
lung adenocarcinoma -1.200 4.1e-09
lung carcinoma 1.100 3.4e-14
medulloblastoma -1.800 5.8e-05
medulloblastoma, large-cell -2.700 1.2e-03
oligodendroglioma -1.600 1.3e-02
osteosarcoma -1.344 6.6e-06
primitive neuroectodermal tumor -1.600 3.6e-03

Gene RIF (14)

AA Sequence

MIDSSKKQQQGFPEILTAGDFEPLKEKECLEGSNQKSLKEVLQLRLQQRRTREQLVDQGIMPPLKSPAAF      1 - 70
HEQIKSLERARTENFLKHKIRSRPDRSELVRMHILEETFAEPSLQATQMKLKRARLADDLNEKIAQRPGP     71 - 140
MELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESP    141 - 210
SPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNPNDKHRSK    211 - 280
KCKDPKPRVKKLKYHQYIPPDQKGEKNEPQMDSNYARLLQQQQLFLQLQILSQQKQHYNYQTILPAPFKP    281 - 350
LNDKNSNSGNSALNNATPNTPRQNTSTPVRKPGPLPSSLDDLKVSELKTELKLRGLPVSGTKPDLIERLK    351 - 420
PYQEVNSSGLAAGGIVAVSSSAIVTSNPEVTVALPVTTLHNTVTSSVSTLKAELPPTGTSNATRVENVHS    421 - 490
PLPISPSPSEQSSLSTDDTNMADTFTEIMTMMSPSQFLSSSPLRMTNNEDSLSPTSSTLSNLELDAAEKD    491 - 560
RKLQEKEKQIEELKRKLEQEQKLVEVLKMQLEVEKRGQQQRPLEAQPSAPGHSVKSDQKHGSLGSSIKDE    561 - 630
ASLPDCSSSRQPIPVASHAVGQPVSTGGQTLVAKKAVVIKQEVPVGQAEQQSVVSQFYVSSQGQPPPAVV    631 - 700
AQPQALLTTQTAQLLLPVSIQGSSVTSVQLPVGSLKLQTSPQAGMQTQPQIATAAQIPTAALASGLAPTV    701 - 770
PQTQDTFPQHVLSQPQQVRKVFTNSASSNTVLPYQRHPAPAVQQPFINKASNSVLQSRNAPLPSLQNGPN    771 - 840
TPNKPSSPPPPQQFVVQHSLFGSPVAKTKDPPRYEEAIKQTRSTQAPLPEISNAHSQQMDDLFDILIKSG    841 - 910
EISLPIKEEPSPISKMRPVTASITTMPVNTVVSRPPPQVQMAPPVSLEPMGSLSASLENQLEAFLDGTLP    911 - 980
SANEIPPLQSSSEDREPFSLIEDLQNDLLSHSGMLDHSHSPMETSETQFAAGTPCLSLDLSDSNLDNMEW    981 - 1050
LDITMPNSSSGLTPLSTTAPSMFSADFLDPQDLPLPWD                                   1051 - 1088
//

Text Mined References (39)

PMID Year Title