Property Summary

NCBI Gene PubMed Count 29
Grant Count 34
R01 Count 28
Funding $2,532,020.58
PubMed Score 16.40
PubTator Score 17.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.143 0.007
astrocytoma -2.300 0.024
ependymoma -2.100 0.004
oligodendroglioma -1.700 0.000
glioblastoma -2.000 0.000
osteosarcoma -1.344 0.000
atypical teratoid / rhabdoid tumor -1.500 0.001
medulloblastoma -1.800 0.000
medulloblastoma, large-cell -2.700 0.001
primitive neuroectodermal tumor -1.600 0.004
Breast cancer -3.200 0.024
lung adenocarcinoma -1.200 0.000
lung carcinoma 1.100 0.000
dermatomyositis 1.200 0.001

Gene RIF (14)

PMID Text
26498848 Study showed that MRTF-A and MRTF-B were upregulated in pancreatic cancer tissues supporting the hypothesis that both of them are oncogenes in pancreatic cancer.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that MKL2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with MKL2
24968937 There were multiple independent HIV integrations in several genes, including MKL2 and BACH2; many of these integrations were in clonally expanded cells.
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that MKL2 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with MKL2
23853104 MKL1/2 depletion resulted in Ras activation, elevated p16 expression and hypophosphorylation of the retinoblastoma (Rb) protein in DLC1-deficient hepatocellular carcinoma cells.
23692340 While disruption of the MKL2:SRF axis has been associated with severe microcephaly and disordered brain development in multiple model systems, the role of this transcription factor complex has not been previously demonstrated in human brain development.
23672313 Based on a recurrent translocation t(11;16)(q13;p13), the C11orf95-MKL2 fusion gene has been found in eight further cases of chondroid lipomas.
22139079 study provides evidence that MKL1/2 mediates cancerous transformation in DLC1-deficient hepatocellular and mammary carcinoma cells
20607705 C11orf95-MKL2 is the resulting fusion oncogene of t(11;16)(q13;p13) in chondroid lipoma.
20442744 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MIDSSKKQQQGFPEILTAGDFEPLKEKECLEGSNQKSLKEVLQLRLQQRRTREQLVDQGIMPPLKSPAAF      1 - 70
HEQIKSLERARTENFLKHKIRSRPDRSELVRMHILEETFAEPSLQATQMKLKRARLADDLNEKIAQRPGP     71 - 140
MELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESP    141 - 210
SPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNPNDKHRSK    211 - 280
KCKDPKPRVKKLKYHQYIPPDQKGEKNEPQMDSNYARLLQQQQLFLQLQILSQQKQHYNYQTILPAPFKP    281 - 350
LNDKNSNSGNSALNNATPNTPRQNTSTPVRKPGPLPSSLDDLKVSELKTELKLRGLPVSGTKPDLIERLK    351 - 420
PYQEVNSSGLAAGGIVAVSSSAIVTSNPEVTVALPVTTLHNTVTSSVSTLKAELPPTGTSNATRVENVHS    421 - 490
PLPISPSPSEQSSLSTDDTNMADTFTEIMTMMSPSQFLSSSPLRMTNNEDSLSPTSSTLSNLELDAAEKD    491 - 560
RKLQEKEKQIEELKRKLEQEQKLVEVLKMQLEVEKRGQQQRPLEAQPSAPGHSVKSDQKHGSLGSSIKDE    561 - 630
ASLPDCSSSRQPIPVASHAVGQPVSTGGQTLVAKKAVVIKQEVPVGQAEQQSVVSQFYVSSQGQPPPAVV    631 - 700
AQPQALLTTQTAQLLLPVSIQGSSVTSVQLPVGSLKLQTSPQAGMQTQPQIATAAQIPTAALASGLAPTV    701 - 770
PQTQDTFPQHVLSQPQQVRKVFTNSASSNTVLPYQRHPAPAVQQPFINKASNSVLQSRNAPLPSLQNGPN    771 - 840
TPNKPSSPPPPQQFVVQHSLFGSPVAKTKDPPRYEEAIKQTRSTQAPLPEISNAHSQQMDDLFDILIKSG    841 - 910
EISLPIKEEPSPISKMRPVTASITTMPVNTVVSRPPPQVQMAPPVSLEPMGSLSASLENQLEAFLDGTLP    911 - 980
SANEIPPLQSSSEDREPFSLIEDLQNDLLSHSGMLDHSHSPMETSETQFAAGTPCLSLDLSDSNLDNMEW    981 - 1050
LDITMPNSSSGLTPLSTTAPSMFSADFLDPQDLPLPWD                                   1051 - 1088
//

Text Mined References (39)

PMID Year Title
26498848 2016 The MRTF-A/B function as oncogenes in pancreatic cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24968937 2014 HIV latency. Specific HIV integration sites are linked to clonal expansion and persistence of infected cells.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24770850 2014 Genome-wide association study of sexual maturation in males and females highlights a role for body mass and menarche loci in male puberty.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23853104 2013 Depletion of the transcriptional coactivators megakaryoblastic leukaemia 1 and 2 abolishes hepatocellular carcinoma xenograft growth by inducing oncogene-induced senescence.
More...