Property Summary

NCBI Gene PubMed Count 41
PubMed Score 62.63
PubTator Score 50.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.375 5.8e-05
astrocytoma 1.400 3.3e-02
autosomal dominant Emery-Dreifuss muscul... 1.265 1.7e-03
Breast cancer 1.400 3.3e-04
Duchenne muscular dystrophy 1.323 1.5e-06
gastric carcinoma 1.300 2.1e-02
juvenile dermatomyositis 1.830 3.3e-12
ovarian cancer 1.400 2.7e-03
pancreatic cancer 1.600 2.2e-03
pancreatic ductal adenocarcinoma liver m... 1.051 1.3e-02
primary Sjogren syndrome 1.300 1.1e-04
Rheumatoid arthritis 2.100 2.3e-03
sarcoidosis 1.100 3.2e-02
subependymal giant cell astrocytoma 1.325 2.5e-02
ulcerative colitis 1.500 1.9e-05

Gene RIF (22)

AA Sequence

MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTA      1 - 70
LQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLS     71 - 140
HNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKE    141 - 210
RRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQD    211 - 280
EEKKQLTALRDLIKSSLQLDQKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVK    281 - 350
NGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT    351 - 420
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISR    421 - 490
IQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCSTS    491 - 560
SAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNL    561 - 630
DKQTALGNTVLHYCSMYSKPECLKLLLRSKPTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPH    631 - 700
VHVEYEWNLRQEEIDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAF    701 - 770
TNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD    771 - 840
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQKVALRKTDHLS    841 - 910
LDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPGELPPKPQLGDLPPKPQLSDL    911 - 980
PPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPT    981 - 1050
LPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFP   1051 - 1120
VSFVHILSD                                                                1121 - 1129
//

Text Mined References (50)

PMID Year Title