Property Summary

NCBI Gene PubMed Count 40
PubMed Score 60.73
PubTator Score 50.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.2701175926502E-12
ulcerative colitis 2087 4.06565499074714E-7
Duchenne muscular dystrophy 602 1.46923988050836E-6
acute quadriplegic myopathy 1157 5.82343157604399E-5
primary Sjogren syndrome 789 1.08230889721557E-4
Breast cancer 3099 3.30812977677767E-4
pancreatic cancer 2300 8.11207005712142E-4
primary pancreatic ductal adenocarcinoma 1271 8.70215948967441E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00168169151510696
Rheumatoid Arthritis 1171 0.00232194712507794
ovarian cancer 8492 0.00269375145852531
gastric carcinoma 832 0.0209237015439881
subependymal giant cell astrocytoma 2287 0.0249967149888595
sarcoidosis 368 0.0316366126283175
astrocytoma 1493 0.0328333287985967
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0
Disease Target Count
pulmonary tuberculosis 8
tuberculosis 1563

Expression

Synonym

Accession Q9ULH1 B2RNV3
Symbols PAP
PAG2
AMAP1
DDEF1
ZG14P
CENTB4

Gene

PDB

2D1X   2DA0   2ED1   2RQT   2RQU  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
624377 screening 680 / 0 / 362197 Fluorescence polarization-based biochemical primary high throughput screening assay to identify inhibitors of ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 (ASAP1)
624386 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 (ASAP1)
624431 screening 230 / 0 / 392 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 (ASAP1)
651680 confirmatory 8 / 0 / 81 Fluorescence polarization-based biochemical high throughput dose response assay for inhibitors of ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 (ASAP1)

Gene RIF (21)

PMID Text
26893376 results support the hypothesis that ASAP1 is a positive regulator of NM2A.
25774636 High ASAP1 expression, that was reduced after Mycobacterium tuberculosis infection, and rs10956514, are associated with the level of reduction of ASAP1 expression.
25673879 Rab11-FIP3 coordinates the interactions of ASAP1 and Rab11a with Rabin8.
24865276 The activation of NF-kappaB induced translocation of AMAP1 to cytoplasm from cell membrane and nucleus, which resulted in augmented interaction of AMAP1 and IKKbeta
24788532 ASAP1 appears to contribute to the malignant mechanism of LSCC and may represent a significant prognostic marker for laryngeal squamous cell carcinoma patients.
24427349 results indicated that elevated expression of ASAP1 plays an important role in the progression and metastasis of ovarian cancer
24116160 Data show that co-overexpression of GEP100 and AMAP1 (ASAP1) correlates with rapidity of the local recurrence.
22734003 found that AMAP1 had the ability to bind directly to PRKD2 and hence to make a complex with the cytoplasmic tail of the beta1 subunit
21858086 Data suggest that GEP100-Arf6-AMAP1-cortactin pathway, activated by VEGFR2, appears to be common in angiogenesis and cancer invasion and metastasis, and provides their new therapeutic targets.
21352810 GEFH1 was identified as binding partner for the BAR domain of ASAP1.GEFH1 is a negative regulator of podosomes.
More...

AA Sequence

MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLLEEALDQDRTA      1 - 70
LQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVKFSTLTKELSTLLKNLLQGLS     71 - 140
HNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKIEKEKREHAKQHGMIRTEITGAEIAEEMEKE    141 - 210
RRLFQLQMCEYLIKVNEIKTKKGVDLLQNLIKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQD    211 - 280
EEKKQLTALRDLIKSSLQLDQKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVK    281 - 350
NGILTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT    351 - 420
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGIHREMGVHISR    421 - 490
IQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRKEYITAKYVDHRFSRKTCSTS    491 - 560
SAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQELGETALHLAVRTADQTSLHLVDFLVQNCGNL    561 - 630
DKQTALGNTVLHYCSMYSKPECLKLLLRSKPTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPH    631 - 700
VHVEYEWNLRQEEIDESDDDLDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAF    701 - 770
TNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD    771 - 840
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQKVALRKTDHLS    841 - 910
LDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPGELPPKPQLGDLPPKPQLSDL    911 - 980
PPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPT    981 - 1050
LPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFP   1051 - 1120
VSFVHILSD                                                                1121 - 1129
//

Text Mined References (49)

PMID Year Title
26893376 2016 The Arf GTPase-activating Protein, ASAP1, Binds Nonmuscle Myosin 2A to Control Remodeling of the Actomyosin Network.
25774636 2015 Susceptibility to tuberculosis is associated with variants in the ASAP1 gene encoding a regulator of dendritic cell migration.
25673879 2015 The Arf and Rab11 effector FIP3 acts synergistically with ASAP1 to direct Rabin8 in ciliary receptor targeting.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24865276 2014 AMAP1 as a negative-feedback regulator of nuclear factor-?B under inflammatory conditions.
24788532 2014 ASAP1 mediates the invasive phenotype of human laryngeal squamous cell carcinoma to affect survival prognosis.
24427349 2014 Overexpression of ASAP1 is associated with poor prognosis in epithelial ovarian cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116160 2013 Co-overexpression of GEP100 and AMAP1 proteins correlates with rapid local recurrence after breast conservative therapy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...