Property Summary

NCBI Gene PubMed Count 29
Grant Count 26
R01 Count 19
Funding $2,131,861.51
PubMed Score 235.03
PubTator Score 20.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
26083449 the existence of novel Kidins220/ARMS splice isoforms with unique properties
25636783 Our results establish the role of ARMS in microglial activation by HIV Tat
25636783 Depletion of ARMS abrogates HIV-1 Tat-induced upregulation of CD40 expression in primary human microglia
25636783 Depletion of ARMS abrogates HIV-1 Tat-induced upregulation of CD40 expression in primary human microglia
23999075 Kidins220 is expressed in neuroblastoma tumors and stabilizes NGF-induced, but not BDNF-induced, survival signaling in neuroblastoma cell lines.
23359496 Kidins220 is a novel T-cell receptor (TCR)-interacting protein that couples B-Raf to the TCR. Kidins220 is mandatory for sustained Erk signaling and is crucial for TCR-mediated T cell activation.
23333500 Kidins220 depletion is associated with the neural-to Schwann-like transition in neuroblastoma.
23118350 Kidins220 levels are increased in human brain necropsies from Alzheimer's disease patients. Kidins220 localizes within hyperphosphorylated tau aggregates, and is a substrate for GSK3beta.
22609016 a novel partner of Kidins220/ARMS
22562556 Kidins220/ARMS is a functional mediator of multiple receptor signalling pathways.
More...

AA Sequence

MSVLISQSVINYVEEENIPALKALLEKCKDVDERNECGQTPLMIAAEQGNLEIVKELIKNGANCNLEDLD      1 - 70
NWTALISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYP     71 - 140
IIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQEGANSMTALIVA    141 - 210
VKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGG    211 - 280
HVEIVRALLQKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEV    281 - 350
VELLLDKGAKVSAVDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILT    351 - 420
QIFGARHLSPTETDGDMLGYDLYSSALADILSEPTMQPPICVGLYAQWGSGKSFLLKKLEDEMKTFAGQQ    421 - 490
IEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHPNLGIAVSLSFLALLYIFFIVIYFGGRREGESWNWAWVL    491 - 560
STRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFG    561 - 630
FLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISIASVV    631 - 700
GLAFVLNCRTWWQVLDSLLNSQRKRLHNAASKLHKLKSEGFMKVLKCEVELMARMAKTIDSFTQNQTRLV    701 - 770
VIIDGLDACEQDKVLQMLDTVRVLFSKGPFIAIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHL    771 - 840
PVFLNSRGLSNARKFLVTSATNGDVPCSDTTGIQEDADRRVSQNSLGEMTKLGSKTALNRRDTYRRRQMQ    841 - 910
RTITRQMSFDLTKLLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTS    911 - 980
WLILYLEETEGIPDQMTLKTIYERISKNIPTTKDVEPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPC    981 - 1050
TVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVSPQP   1051 - 1120
HSSYYSGMTGPQHPFYNRPFFAPYLYTPRYYPGGSQHLISRPSVKTSLPRDQNNGLEVIKEDAAEGLSSP   1121 - 1190
TDSSRGSGPAPGPVVLLNSLNVDAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMN   1191 - 1260
MNFGDWHLFRSTVLEMRNAESHVVPEDPRFLSESSSGPAPHGEPARRASHNELPHTELSSQTPYTLNFSF   1261 - 1330
EELNTLGLDEGAPRHSNLSWQSQTRRTPSLSSLNSQDSSIEISKLTDKVQAEYRDAYREYIAQMSQLEGG   1331 - 1400
PGSTTISGRSSPHSTYYMGQSSSGGSIHSNLEQEKGKDSEPKPDDGRKSFLMKRGDVIDYSSSGVSTNDA   1401 - 1470
SPLDPITEEDEKSDQSGSKLLPGKKSSERSSLFQTDLKLKGSGLRYQKLPSDEDESGTEESDNTPLLKDD   1471 - 1540
KDRKAEGKVERVPKSPEHSAEPIRTFIKAKEYLSDALLDKKDSSDSGVRSSESSPNHSLHNEVADDSQLE   1541 - 1610
KANLIELEDDSHSGKRGIPHSLSGLQDPIIARMSICSEDKKSPSECSLIASSPEENWPACQKAYNLNRTP   1611 - 1680
STVTLNNNSAPANRANQNFDEMEGIRETSQVILRPSSSPNPTTIQNENLKSMTHKRSQRSSYTRLSKDPP   1681 - 1750
ELHAAASSESTGFGEERESIL                                                    1751 - 1771
//

Text Mined References (41)

PMID Year Title
26083449 2015 Novel Kidins220/ARMS Splice Isoforms: Potential Specific Regulators of Neuronal and Cardiovascular Development.
25636783 2015 Investigating the role of ankyrin-rich membrane spanning protein in human immunodeficiency virus type-1 Tat-induced microglia activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23999075 2013 Kidins220/ARMS is expressed in neuroblastoma tumors and stabilizes neurotrophic signaling in a human neuroblastoma cell line.
23359496 2013 Kidins220/ARMS associates with B-Raf and the TCR, promoting sustained Erk signaling in T cells.
23333500 2013 Kidins220/ARMS depletion is associated with the neural-to Schwann-like transition in a human neuroblastoma cell line model.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23118350 2013 Kidins220 accumulates with tau in human Alzheimer's disease and related models: modulation of its calpain-processing by GSK3?/PP1 imbalance.
22609016 2012 Kidins220/ARMS interacts with Pdzrn3, a protein containing multiple binding domains.
22562556 2012 Kidins220/ARMS as a functional mediator of multiple receptor signalling pathways.
More...