Property Summary

NCBI Gene PubMed Count 29
PubMed Score 235.03
PubTator Score 20.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 8.03501678326741E-16
posterior fossa group A ependymoma 1511 8.57707294010486E-15
juvenile dermatomyositis 1189 4.73683415215078E-14
atypical teratoid / rhabdoid tumor 4369 2.03553677567367E-10
glioblastoma 5572 8.38990373868949E-9
medulloblastoma 1524 1.50393461553788E-8
pediatric high grade glioma 2712 1.74806192641654E-8
acute quadriplegic myopathy 1157 1.99189608826162E-8
pilocytic astrocytoma 3086 3.10801196111663E-8
medulloblastoma, large-cell 6234 1.02962131350131E-7
Duchenne muscular dystrophy 602 8.15564370058955E-7
malignant mesothelioma 3163 2.40641517498731E-6
psoriasis 6685 1.49624180283625E-4
primitive neuroectodermal tumor 3031 3.471289859256E-4
osteosarcoma 7933 5.19274882669488E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 7.33936112230897E-4
oligodendroglioma 2849 0.00106899281591317
dermatomyositis 967 0.00435685684429358
astrocytic glioma 2241 0.00478677848394668
non primary Sjogren syndrome sicca 840 0.00787326498225966
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00817830839534073
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0107550967079925
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0113781494149727
lung cancer 4473 0.0124189996570684
progressive supranuclear palsy 674 0.0183531955124672
subependymal giant cell astrocytoma 2287 0.0401927968882193
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q9ULH0 A1L4N4 Q4VC08 Q6MZU2 Q9H889 Q9H9E4 Q9NT37 Q9UF42
Symbols ARMS

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (15)

PMID Text
26083449 the existence of novel Kidins220/ARMS splice isoforms with unique properties
25636783 Our results establish the role of ARMS in microglial activation by HIV Tat
25636783 Depletion of ARMS abrogates HIV-1 Tat-induced upregulation of CD40 expression in primary human microglia
23999075 Kidins220 is expressed in neuroblastoma tumors and stabilizes NGF-induced, but not BDNF-induced, survival signaling in neuroblastoma cell lines.
23359496 Kidins220 is a novel T-cell receptor (TCR)-interacting protein that couples B-Raf to the TCR. Kidins220 is mandatory for sustained Erk signaling and is crucial for TCR-mediated T cell activation.
23333500 Kidins220 depletion is associated with the neural-to Schwann-like transition in neuroblastoma.
23118350 Kidins220 levels are increased in human brain necropsies from Alzheimer's disease patients. Kidins220 localizes within hyperphosphorylated tau aggregates, and is a substrate for GSK3beta.
22609016 a novel partner of Kidins220/ARMS
22562556 Kidins220/ARMS is a functional mediator of multiple receptor signalling pathways.
21381019 induction of morphological polarization in primary T lymphocytes and Jurkat cells enhances Kidins220/ARMS colocalization with ICAM-3
More...

AA Sequence

MSVLISQSVINYVEEENIPALKALLEKCKDVDERNECGQTPLMIAAEQGNLEIVKELIKNGANCNLEDLD      1 - 70
NWTALISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYP     71 - 140
IIWAAGRGHADIVHLLLQNGAKVNCSDKYGTTPLVWAARKGHLECVKHLLAMGADVDQEGANSMTALIVA    141 - 210
VKGGYTQSVKEILKRNPNVNLTDKDGNTALMIASKEGHTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGG    211 - 280
HVEIVRALLQKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEV    281 - 350
VELLLDKGAKVSAVDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILT    351 - 420
QIFGARHLSPTETDGDMLGYDLYSSALADILSEPTMQPPICVGLYAQWGSGKSFLLKKLEDEMKTFAGQQ    421 - 490
IEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHPNLGIAVSLSFLALLYIFFIVIYFGGRREGESWNWAWVL    491 - 560
STRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFG    561 - 630
FLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISIASVV    631 - 700
GLAFVLNCRTWWQVLDSLLNSQRKRLHNAASKLHKLKSEGFMKVLKCEVELMARMAKTIDSFTQNQTRLV    701 - 770
VIIDGLDACEQDKVLQMLDTVRVLFSKGPFIAIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVHL    771 - 840
PVFLNSRGLSNARKFLVTSATNGDVPCSDTTGIQEDADRRVSQNSLGEMTKLGSKTALNRRDTYRRRQMQ    841 - 910
RTITRQMSFDLTKLLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTS    911 - 980
WLILYLEETEGIPDQMTLKTIYERISKNIPTTKDVEPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPC    981 - 1050
TVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVSPQP   1051 - 1120
HSSYYSGMTGPQHPFYNRPFFAPYLYTPRYYPGGSQHLISRPSVKTSLPRDQNNGLEVIKEDAAEGLSSP   1121 - 1190
TDSSRGSGPAPGPVVLLNSLNVDAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMN   1191 - 1260
MNFGDWHLFRSTVLEMRNAESHVVPEDPRFLSESSSGPAPHGEPARRASHNELPHTELSSQTPYTLNFSF   1261 - 1330
EELNTLGLDEGAPRHSNLSWQSQTRRTPSLSSLNSQDSSIEISKLTDKVQAEYRDAYREYIAQMSQLEGG   1331 - 1400
PGSTTISGRSSPHSTYYMGQSSSGGSIHSNLEQEKGKDSEPKPDDGRKSFLMKRGDVIDYSSSGVSTNDA   1401 - 1470
SPLDPITEEDEKSDQSGSKLLPGKKSSERSSLFQTDLKLKGSGLRYQKLPSDEDESGTEESDNTPLLKDD   1471 - 1540
KDRKAEGKVERVPKSPEHSAEPIRTFIKAKEYLSDALLDKKDSSDSGVRSSESSPNHSLHNEVADDSQLE   1541 - 1610
KANLIELEDDSHSGKRGIPHSLSGLQDPIIARMSICSEDKKSPSECSLIASSPEENWPACQKAYNLNRTP   1611 - 1680
STVTLNNNSAPANRANQNFDEMEGIRETSQVILRPSSSPNPTTIQNENLKSMTHKRSQRSSYTRLSKDPP   1681 - 1750
ELHAAASSESTGFGEERESIL                                                    1751 - 1771
//

Text Mined References (41)

PMID Year Title
26083449 2015 Novel Kidins220/ARMS Splice Isoforms: Potential Specific Regulators of Neuronal and Cardiovascular Development.
25636783 2015 Investigating the role of ankyrin-rich membrane spanning protein in human immunodeficiency virus type-1 Tat-induced microglia activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23999075 2013 Kidins220/ARMS is expressed in neuroblastoma tumors and stabilizes neurotrophic signaling in a human neuroblastoma cell line.
23359496 2013 Kidins220/ARMS associates with B-Raf and the TCR, promoting sustained Erk signaling in T cells.
23333500 2013 Kidins220/ARMS depletion is associated with the neural-to Schwann-like transition in a human neuroblastoma cell line model.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23118350 2013 Kidins220 accumulates with tau in human Alzheimer's disease and related models: modulation of its calpain-processing by GSK3?/PP1 imbalance.
22609016 2012 Kidins220/ARMS interacts with Pdzrn3, a protein containing multiple binding domains.
22562556 2012 Kidins220/ARMS as a functional mediator of multiple receptor signalling pathways.
More...