Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.26
PubTator Score 10.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.500 1.6e-03
autosomal dominant Emery-Dreifuss muscul... 1.170 3.2e-04
Breast cancer 3.500 3.3e-02
diabetes mellitus -1.100 3.2e-03
Duchenne muscular dystrophy 1.040 3.9e-07
ependymoma -1.600 2.0e-02
glioblastoma -1.300 1.1e-04
medulloblastoma, large-cell -1.200 4.2e-03
oligodendroglioma -1.200 6.2e-17
ovarian cancer -1.700 1.9e-03
pancreatic cancer 1.200 2.6e-04
primary pancreatic ductal adenocarcinoma 1.552 5.6e-03
primary Sjogren syndrome 1.200 3.6e-03

Gene RIF (6)

AA Sequence

MKVHMHTKFCLICLLTFIFHHCNHCHEEHDHGPEALHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFER      1 - 70
YGENGRLSFFGLEKLLTNLGLGERKVVEINHEDLGHDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQ     71 - 140
TVTSVSTKRNHKCDPEKETVEVSVKSDDKHMHDHNHRLRHHHRLHHHLDHNNTHHFHNDSITPSERGEPS    141 - 210
NEPSTETNKTQEQSDVKLPKGKRKKKGRKSNENSEVITPGFPPNHDQGEQYEHNRVHKPDRVHNPGHSHV    211 - 280
HLPERNGHDPGRGHQDLDPDNEGELRHTRKREAPHVKNNAIISLRKDLNEDDHHHECLNVTQLLKYYGHG    281 - 350
ANSPISTDLFTYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDEANIGASAWICGIISITVISLL    351 - 420
SLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPHSQGGHDHSHQHAHGHGHSHGHESNKFLE    421 - 490
EYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQ    491 - 560
LKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGLHTIHEHDLHAAAHNHHG    561 - 630
ENKTVLRKHNHQWHHKHSHHSHGPCHSGSDLKETGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGI    631 - 700
STSIAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAVTAGM    701 - 770
FLYVALVDMLPEMLHGDGDNEEHGFCPVGQFILQNLGLLFGFAIMLVIALYEDKIVFDIQF             771 - 831
//

Text Mined References (16)

PMID Year Title