Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
Funding $165,975
PubMed Score 14.55
PubTator Score 10.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q9ULF5 A8K5C6 B4DGU0 Q3MJA4 Q68CR5 Q6DKH6 Q9Y3Z1
Symbols LZT-Hs2

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (5)

PMID Text
25200496 A significant correlation between ZIP10 mRNA expressions with aggressiveness of RCC.
24587242 Zinc and its transporters, ZIP6 and ZIP10, are required for the breast cancer cells motility stimulated with high glucose level, such as in diabetes.
23898208 HIV-1 Tat upregulates the expression of solute carrier family 39 (zinc transporter), member 10 (SLC39A10) in human primary T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKVHMHTKFCLICLLTFIFHHCNHCHEEHDHGPEALHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFER      1 - 70
YGENGRLSFFGLEKLLTNLGLGERKVVEINHEDLGHDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQ     71 - 140
TVTSVSTKRNHKCDPEKETVEVSVKSDDKHMHDHNHRLRHHHRLHHHLDHNNTHHFHNDSITPSERGEPS    141 - 210
NEPSTETNKTQEQSDVKLPKGKRKKKGRKSNENSEVITPGFPPNHDQGEQYEHNRVHKPDRVHNPGHSHV    211 - 280
HLPERNGHDPGRGHQDLDPDNEGELRHTRKREAPHVKNNAIISLRKDLNEDDHHHECLNVTQLLKYYGHG    281 - 350
ANSPISTDLFTYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDEANIGASAWICGIISITVISLL    351 - 420
SLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPHSQGGHDHSHQHAHGHGHSHGHESNKFLE    421 - 490
EYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQ    491 - 560
LKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIEEEKIIDHSHSDGLHTIHEHDLHAAAHNHHG    561 - 630
ENKTVLRKHNHQWHHKHSHHSHGPCHSGSDLKETGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGI    631 - 700
STSIAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAVTAGM    701 - 770
FLYVALVDMLPEMLHGDGDNEEHGFCPVGQFILQNLGLLFGFAIMLVIALYEDKIVFDIQF             771 - 831
//

Text Mined References (16)

PMID Year Title
25200496 2014 Association between ZIP10 gene expression and tumor aggressiveness in renal cell carcinoma.
24587242 2014 High glucose level promotes migration behavior of breast cancer cells through zinc and its transporters.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17359283 2007 Zinc and its transporter ZIP10 are involved in invasive behavior of breast cancer cells.
More...