Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.90
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.089 1.1e-02
active ulcerative colitis 1.042 8.8e-03
astrocytoma 1.100 8.7e-03
lung adenocarcinoma -1.300 6.0e-11
lung cancer -2.600 6.0e-05
lung carcinoma -1.400 1.4e-22
malignant mesothelioma 1.300 5.4e-07
osteosarcoma -1.671 3.7e-04
ovarian cancer 1.200 3.8e-05
pancreatic cancer 1.600 2.5e-03
primary pancreatic ductal adenocarcinoma 1.608 3.7e-03
psoriasis -1.700 1.3e-04
Rheumatoid arthritis 2.000 1.3e-03

Gene RIF (1)

AA Sequence

MDHINKLTQIEDPREQWRREQERMLKEYLIVAQEALNAKKEIYQIKQQRFELAQEEYQQLHKMCEDDSRS      1 - 70
YASSFSGYSTNTKYDPHQIKAEIASRRDRLSRLKRELTQMKQELQYKEKGVETLQEIDRKMSSTHTSYKL     71 - 140
DEAQAIMSELRTIKKAICTGEKERRDLMHSLAKLTDSFKNSCSVTDSLVDFPHHVGVPGDAGVPQQFCDA    141 - 210
GSQTDIIGEFVFDDKTRLVDRVRLNWQYEEARKRVANIQQQLARLDNESWPSTAEADRDRLQLIKEKEAL    211 - 280
LQELQLIIAQRRSAGDVARLEEERERLEEELRRARATSAQGATERILLQEKRNCLLMQLEEATRLTSYLQ    281 - 350
SQLKSLCASTLTVSSGSSRGSLASSRGSLASSRGSLSSVSFTDIYGLPQYEKPDAEGSQLLRFDLIPFDS    351 - 420
LGRDAPFSEPPGPSGFHKQRRSLDTPQSLASLSSRSSLSSLSPPSSPLDTPFLPASRDSPLAQLADSCEG    421 - 490
PGLGALDRLRAHASAMGDEDLPGMAALQPHGVPGDGEGPHERGPPPASAPVGGTVTLREDSAKRLERRAR    491 - 560
RISACLSDYSLASDSGVFEPLTKRNEDAEEPAYGDTASNGDPQIHVGLLRDSGSECLLVHVLQLKNPAGL    561 - 630
AVKEDCKVHIRVYLPPLDSGTPNTYCSKALEFQVPLVFNEVFRIPVHSSALTLKSLQLYVCSVTPQLQEE    631 - 700
LLGIAQINLADYDSLSEMQLRWHSVQVFTSSEPSRTREAGCAGESSARDPAHTISISGKTDAVTVLLART    701 - 770
TAQLQAVERELAEERAKLEYTEEEVLEMERKEEQAEAISERSWQADSVDSGCSNCTQTSPPYPEPCCMGI    771 - 840
DSILGHPFAAQAGPYSPEKFQPSPLKVDKETNTEDLFLEEAASLVKERPSRRARGSPFVRSGTIVRSQTF    841 - 910
SPGARSQYVCRLYRSDSDSSTLPRKSPFVRNTLERRTLRYKQSCRSSLAELMARTSLDLELDLQASRTRQ    911 - 980
RQLNEELCALRELRQRLEDAQLRGQTDLPPWVLRDERLRGLLREAERQTRQTKLDYRHEQAAEKMLKKAS    981 - 1050
KEIYQLRGQSHKEPIQVQTFREKIAFFTRPRINIPPLPADDV                               1051 - 1092
//

Text Mined References (12)

PMID Year Title