Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.47
PubTator Score 2.36

Knowledge Summary


No data available


  Differential Expression (11)

AA Sequence

GYPLIPGQYDPFQGLTSAALVASQQVAAQASASGMFPGQRRE                               1471 - 1512

Text Mined References (22)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24465431 2014 Familial young-onset diabetes, pre-diabetes and cardiovascular disease are associated with genetic variants of DACH1 in Chinese.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.