Property Summary

Ligand Count 3
NCBI Gene PubMed Count 8
PubMed Score 11.84
PubTator Score 4.88

Knowledge Summary

Patent (1,949)

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.700 1.0e-03
astrocytoma -1.200 6.5e-22
Astrocytoma, Pilocytic -1.700 2.7e-06
atypical teratoid / rhabdoid tumor -2.300 4.6e-10
ependymoma -1.500 3.4e-11
glioblastoma -1.400 1.8e-07
group 3 medulloblastoma -1.700 8.0e-03
medulloblastoma, large-cell -1.600 2.0e-03
oligodendroglioma -1.300 6.9e-20
primitive neuroectodermal tumor -1.900 9.7e-06

Gene RIF (3)

AA Sequence

MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEVMQRGCACSFL      1 - 70
YGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEKGEVALFLVSHKDISETKNRG     71 - 140
GPDRWKETGGGRRRYGRARSKGFNANRRRSRAVLYHLSGHLQKQPKGKHKLNKGVFGEKPNLPEYKVAAI    141 - 210
RKSPFILLHCGALRATWDGFILLATLYVAVTVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNF    211 - 280
RTTFVSKSGQVVFAPKSICLHYVTTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLD    281 - 350
RYSQYSAVVLTLLMAVFALLAHWVACVWFYIGQREIESSESELPEIGWLQELARRLETPYYLVGRRPAGG    351 - 420
NSSGQSDNCSSSSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKIFSICTMLIGA    421 - 490
LMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRMLEYFQATWAVNNGIDTTELLQS    491 - 560
LPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSMEVL    561 - 630
KGGTVLAILGKGDLIGCELPRREQVVKANADVKGLTYCVLQCLQLAGLHDSLALYPEFAPRFSRGLRGEL    631 - 700
SYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSP    701 - 770
RRTAPRPRLGGRGRPGRAGALKAEAGPSAPPRALEGLRLPPMPWNVPPDLSPRVVDGIEDGCGSDQPKFS    771 - 840
FRVGQSGPECSSSPSPGPESGLLTVPHGPSEARNTDTLDKLRQAVTELSEQVLQMREGLQSLRQAVQLVL    841 - 910
APHREGPCPRASGEGPCPASTSGLLQPLCVDTGASSYCLQPPAGSVLSGTWPHPRPGPPPLMAPWPWGPP    911 - 980
ASQSSPWPRATAFWTSTSDSEPPASGDLCSEPSTPASPPPSEEGARTGPAEPVSQAEATSTGEPPPGSGG    981 - 1050
LALPWDPHSLEMVLIGCHGSGTVQWTQEEGTGV                                        1051 - 1083
//

Text Mined References (8)

PMID Year Title