Property Summary

NCBI Gene PubMed Count 8
Grant Count 12
R01 Count 11
Funding $1,982,913.72
PubMed Score 10.24
PubTator Score 4.88

Knowledge Summary

Patent (1,949)


  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.200 0.000
glioblastoma -1.700 0.000
oligodendroglioma -1.300 0.000
posterior fossa group A ependymoma -1.600 0.000
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -1.600 0.002
primitive neuroectodermal tumor -1.900 0.000
adult high grade glioma -1.700 0.001
pilocytic astrocytoma -1.800 0.000

Gene RIF (3)

20638388 report on the binding of HIV-1 gp120 to the cytoplasmic C-terminus of the voltage-gated potassium channel BEC1, an interaction that can result in the repression of BEC's activity and the inhibition of HIV-1 particle-release
20638388 HIV-1 gp120 binds to the C-terminus (amino acids 973-1083) of BEC1 in vitro and in living cells. Overexpression of BEC1 inhibits HIV-1 particle release from 293T cells. This requires the C-terminus of BEC1
19923296 BEC1 is negatively involved in cognitive functions with no abnormal behaviors such as spontaneous seizures or motor dysfunction.

AA Sequence

LALPWDPHSLEMVLIGCHGSGTVQWTQEEGTGV                                        1051 - 1083

Text Mined References (8)

PMID Year Title
26503718 2015 Bimodal regulation of an Elk subfamily K+ channel by phosphatidylinositol 4,5-bisphosphate.
20638388 2010 Interaction of human immunodeficiency virus gp120 with the voltage-gated potassium channel BEC1.
19923296 2009 Disruption of the ether-a-go-go K+ channel gene BEC1/KCNH3 enhances cognitive function.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
12890647 2003 Distribution and functional properties of human KCNH8 (Elk1) potassium channels.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10455180 1999 New ether-à-go-go K(+) channel family members localized in human telencephalon.