Property Summary

NCBI Gene PubMed Count 10
Grant Count 318
R01 Count 205
Funding $46,004,294.14
PubMed Score 47.82
PubTator Score 9.14

Knowledge Summary


No data available


  Differential Expression (9)


Accession Q9ULD6 A1L4N5 D6RAE6 D6RBT4 Q4W5I8 Q86V55
Symbols INT


AA Sequence

HPKPQELYVCFHDSVTEIAIEIAFKLFFGLTL                                          911 - 942

Publication (13)

PMID Year Title
27158779 2016 The ciliopathy-associated CPLANE proteins direct basal body recruitment of intraflagellar transport machinery.
26644512 2015 The polarity protein Inturned links NPHP4 to Daam1 to control the subapical actin network in multiciliated cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21948523 2011 Post-transcriptional exon shuffling events in humans can be evolutionarily conserved and abundant.
21761479 2011 PCP effector proteins inturned and fuzzy play nonredundant roles in the patterning but not convergent extension of mammalian neural tube.
16493421 2006 Ciliogenesis defects in embryos lacking inturned or fuzzy function are associated with failure of planar cell polarity and Hedgehog signaling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.