Property Summary

NCBI Gene PubMed Count 10
PubMed Score 53.86
PubTator Score 9.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Alzheimer's disease -1.400 2.4e-02
atypical teratoid/rhabdoid tumor 1.200 1.2e-03
chronic rhinosinusitis -1.684 1.2e-02
cystic fibrosis and chronic rhinosinusit... -1.493 1.4e-02
ependymoma 1.200 4.1e-04
interstitial cystitis -1.300 3.9e-04
ovarian cancer -2.500 1.7e-12
Pick disease -1.700 2.1e-05
progressive supranuclear palsy -1.500 7.6e-03

AA Sequence

MASVASCDSRPSSDELPGDPSSQEEDEDYDFEDRVSDSGSYSSASSDYDDLEPEWLDSVQKNGELFYLEL      1 - 70
SEDEEESLLPETPTVNHVRFSENEIIIEDDYKERKKYEPKLKQFTKILRRKRLLPKRCNKKNSNDNGPVS     71 - 140
ILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVV    141 - 210
HGLLPGGSAMKSGQVLIGDVLVAVNDVDVTTENIERVLSCIPGPMQVKLTFENAYDVKRETSHPRQKKTQ    211 - 280
SNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTL    281 - 350
CDMLENVTGTQVTSSSLLLNGKQIHVAYWKESDKLLLIGLPAEEVPLPRLRNMIENVIQTLKFMYGSLDS    351 - 420
AFCQIENVPRLDHFFNLFFQRALQPAKLHSSASPSAQQYDASSAVLLDNLPGVRWLTLPLEIKMELDMAL    421 - 490
SDLEAADFAELSEDYYDMRRLYTILGSSLFYKGYLICSHLPKDDLIDIAVYCRHYCLLPLAAKQRIGQLI    491 - 560
IWREVFPQHHLRPLADSSTEVFPEPEGRYFLLVVGLKHYMLCVLLEAGGCASKAIGSPGPDCVYVDQVKT    561 - 630
TLHQLDGVDSRIDERLASSPVPCLSCADWFLTGSREKTDSLTTSPILSRLQGTSKVATSPTCRRTLFGDY    631 - 700
SLKTRKPSPSCSSGGSDNGCEGGEDDGFSPHTTPDAVRKQRESQGSDGLEESGTLLKVTKKKSTLPNPFH    701 - 770
LGNLKKDLPEKELEIYNTVKLTSGPENTLFHYVALETVQGIFITPTLEEVAQLSGSIHPQLIKNFHQCCL    771 - 840
SIRAVFQQTLVEEKKKGLNSGDHSDSAKSVSSLNPVKEHGVLFECSPGNWTDQKKAPPVMAYWVVGRLFL    841 - 910
HPKPQELYVCFHDSVTEIAIEIAFKLFFGLTL                                          911 - 942
//

Text Mined References (13)

PMID Year Title