Property Summary

NCBI Gene PubMed Count 24
PubMed Score 61.59
PubTator Score 49.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Liver carcinoma 217
Disease Target Count P-value
ovarian cancer 8492 8.90533894142683E-13
psoriasis 6685 5.96894737783112E-9
malignant mesothelioma 3163 1.01122853777395E-7
posterior fossa group A ependymoma 1511 8.48757303037091E-7
lung cancer 4473 6.08056831589521E-6
atypical teratoid/rhabdoid tumor 1095 5.62442581678829E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.92868118700646E-4
Down syndrome 548 6.24092985449472E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.31972451715598E-4
pediatric high grade glioma 2712 8.26395864961211E-4
osteosarcoma 7933 0.0010577862863674
hereditary spastic paraplegia 313 0.00187681157065298
lung adenocarcinoma 2714 0.00220775750034375
cystic fibrosis 1670 0.00287321493985093
limb girdle muscular dystrophy 2A 156 0.00351455797888215
Pick disease 1893 0.00457010826711661
dermatomyositis 967 0.00523978777849673
pancreatic cancer 2300 0.00683850428409909
glioblastoma 5572 0.00694984941093539
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00778993647127952
primary pancreatic ductal adenocarcinoma 1271 0.00946677366809274
medulloblastoma, large-cell 6234 0.00972731675974011
subependymal giant cell astrocytoma 2287 0.0101441253364599
progressive supranuclear palsy 674 0.0157574591255452
Multiple myeloma 1328 0.0182041004110667
urothelial carcinoma 318 0.0198919628262962
acute quadriplegic myopathy 1157 0.0231629157733961
sonic hedgehog group medulloblastoma 1482 0.0274486656157226
aldosterone-producing adenoma 664 0.0309428862425416
spina bifida 1064 0.0358850273591566
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0425893886374639
Disease Target Count Z-score Confidence
Cowpox 15 3.86 1.9
Disease Target Count
hepatocellular carcinoma 550

Expression

Synonym

Accession Q9ULD2 A8K135 B2RBJ6 B3KWJ9 B4DH03 B9EGA1 D3DSP8 Q63HJ6 Q659F4 Q6PK49 Q6URW7 Q8N4M6 Q8WTT9 Q9H7T2
Symbols ATBP
ATIP
ICIS
MP44
MTSG1

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (2)

Pathway (1)

Gene RIF (20)

PMID Text
26643896 Deregulated microRNA (miRNA) expression has been shown to be involved in the pathogenesis of several types of cancers including colorectal cancer (CRC). MTUS1 targeting miRNAs may play key roles in the development of CRC by downregulating tumor suppressor MTUS1.
26498358 We propose a novel mechanism by which ATIP3-EB1 interaction indirectly reduces the kinetics of EB1 exchange on its recognition site, thereby accounting for negative regulation of microtubule dynamic instability
25885343 Our studies confirm that MTUS1 plays an important role in the progression of salivary adenoid cystic carcinoma , and may serve as a biomarker or therapeutic target for patients with salivary adenoid cystic carcinoma
24650297 Data identifies MTUS1 as a tumour suppressor gene in cultured bladder cancer cells and in advanced bladder tumours.
24299308 The present data suggested MTUS1 as a potential tumor suppressor in gastric cancer and might lead to a better understanding of gastric carcinogenesis.
23396587 analysis of a functional ATIP3 domain that associates with microtubules and recapitulates the effects of ATIP3 on microtubule dynamics, cell proliferation, and migration in breast cancer
22153618 MTUS1 plays major roles in the progression of oral tongue squamous cell carcinoma.
20687230 Results in human prostate cancer cell lines demonstrate the presence of ATIP in both cell lines examined.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19956880 MTUS1 could be involved in the loss of proliferative control in human colon cancer
More...

AA Sequence

MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDYETDPAVVTGENI      1 - 70
SLSLQGVEVFGHEKSSSDFISKQVLDMHKDSICQCPALVGTEKPKYLQHSCHSLEAVEGQSVEPSLPFVW     71 - 140
KPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGKSQSFHTAGSLPPTGRRSGSTSSLSYSTWTS    141 - 210
SHSDKTHARETTYDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGKVTSEYTDGSQ    211 - 280
QRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSYCLIDDEC    281 - 350
PLMVPAFDKSEAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVI    351 - 420
STDKTMCMSTPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPI    421 - 490
GCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSASSPSSVNSRQQTVLSRTPRSD    491 - 560
LNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV    561 - 630
SALFQKIKGILPVKMESAECLEMTYVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFEYGSLFLGSA    631 - 700
SKTTTTSGRNISKPDSCGLRQIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSGKPTSLKT    701 - 770
AQSSWVNLPRPLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNSGNAAVIKYEEKPPKPAFQNGSSG    771 - 840
SFYLKPLVSRAHVHLMKTPPKGPSRKNLFTALNAVEKSRQKNPRSLCIQPQTAPDALPPEKTLELTQYKT    841 - 910
KCENQSGFILQLKQLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTASTTCEKLEK    911 - 980
ARNELQTVYEAFVQQHQAEKTERENRLKEFYTREYEKLRDTYIEEAEKYKMQLQEQFDNLNAAHETSKLE    981 - 1050
IEASHSEKLELLKKAYEASLSEIKKGHEIEKKSLEDLLSEKQESLEKQINDLKSENDALNEKLKSEEQKR   1051 - 1120
RAREKANLKNPQIMYLEQELESLKAVLEIKNEKLHQQDIKLMKMEKLVDNNTALVDKLKRFQQENEELKA   1121 - 1190
RMDKHMAISRQLSTEQAVLQESLEKESKVNKRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSG   1191 - 1260
SFPSPSISPR                                                               1261 - 1270
//

Text Mined References (37)

PMID Year Title
26643896 2016 MTUS1 and its targeting miRNAs in colorectal carcinoma: significant associations.
26498358 2015 Negative regulation of EB1 turnover at microtubule plus ends by interaction with microtubule-associated protein ATIP3.
25885343 2015 MTUS1/ATIP3a down-regulation is associated with enhanced migration, invasion and poor prognosis in salivary adenoid cystic carcinoma.
24650297 2014 Loss of MTUS1/ATIP expression is associated with adverse outcome in advanced bladder carcinomas: data from a retrospective study.
24299308 2014 Loss of MTUS1 in gastric cancer promotes tumor growth and metastasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23396587 2013 ATIP3, a novel prognostic marker of breast cancer patient survival, limits cancer cell migration and slows metastatic progression by regulating microtubule dynamics.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22153618 2012 Down-regulation of tumor suppressor MTUS1/ATIP is associated with enhanced proliferation, poor differentiation and poor prognosis in oral tongue squamous cell carcinoma.
More...