Property Summary

NCBI Gene PubMed Count 24
Grant Count 10
R01 Count 3
Funding $1,126,505
PubMed Score 61.59
PubTator Score 49.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26643896 Deregulated microRNA (miRNA) expression has been shown to be involved in the pathogenesis of several types of cancers including colorectal cancer (CRC). MTUS1 targeting miRNAs may play key roles in the development of CRC by downregulating tumor suppressor MTUS1.
26498358 We propose a novel mechanism by which ATIP3-EB1 interaction indirectly reduces the kinetics of EB1 exchange on its recognition site, thereby accounting for negative regulation of microtubule dynamic instability
25885343 Our studies confirm that MTUS1 plays an important role in the progression of salivary adenoid cystic carcinoma , and may serve as a biomarker or therapeutic target for patients with salivary adenoid cystic carcinoma
24650297 Data identifies MTUS1 as a tumour suppressor gene in cultured bladder cancer cells and in advanced bladder tumours.
24299308 The present data suggested MTUS1 as a potential tumor suppressor in gastric cancer and might lead to a better understanding of gastric carcinogenesis.
23396587 analysis of a functional ATIP3 domain that associates with microtubules and recapitulates the effects of ATIP3 on microtubule dynamics, cell proliferation, and migration in breast cancer
22153618 MTUS1 plays major roles in the progression of oral tongue squamous cell carcinoma.
20687230 Results in human prostate cancer cell lines demonstrate the presence of ATIP in both cell lines examined.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19956880 MTUS1 could be involved in the loss of proliferative control in human colon cancer
More...

AA Sequence

MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDYETDPAVVTGENI      1 - 70
SLSLQGVEVFGHEKSSSDFISKQVLDMHKDSICQCPALVGTEKPKYLQHSCHSLEAVEGQSVEPSLPFVW     71 - 140
KPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGKSQSFHTAGSLPPTGRRSGSTSSLSYSTWTS    141 - 210
SHSDKTHARETTYDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGKVTSEYTDGSQ    211 - 280
QRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSYCLIDDEC    281 - 350
PLMVPAFDKSEAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVI    351 - 420
STDKTMCMSTPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPI    421 - 490
GCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSASSPSSVNSRQQTVLSRTPRSD    491 - 560
LNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV    561 - 630
SALFQKIKGILPVKMESAECLEMTYVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFEYGSLFLGSA    631 - 700
SKTTTTSGRNISKPDSCGLRQIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSGKPTSLKT    701 - 770
AQSSWVNLPRPLPKSKASLKSPALRRTGSTPSIASTHSELSTYSNNSGNAAVIKYEEKPPKPAFQNGSSG    771 - 840
SFYLKPLVSRAHVHLMKTPPKGPSRKNLFTALNAVEKSRQKNPRSLCIQPQTAPDALPPEKTLELTQYKT    841 - 910
KCENQSGFILQLKQLLACGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVNLRGELVTASTTCEKLEK    911 - 980
ARNELQTVYEAFVQQHQAEKTERENRLKEFYTREYEKLRDTYIEEAEKYKMQLQEQFDNLNAAHETSKLE    981 - 1050
IEASHSEKLELLKKAYEASLSEIKKGHEIEKKSLEDLLSEKQESLEKQINDLKSENDALNEKLKSEEQKR   1051 - 1120
RAREKANLKNPQIMYLEQELESLKAVLEIKNEKLHQQDIKLMKMEKLVDNNTALVDKLKRFQQENEELKA   1121 - 1190
RMDKHMAISRQLSTEQAVLQESLEKESKVNKRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSG   1191 - 1260
SFPSPSISPR                                                               1261 - 1270
//

Text Mined References (37)

PMID Year Title
26643896 2016 MTUS1 and its targeting miRNAs in colorectal carcinoma: significant associations.
26498358 2015 Negative regulation of EB1 turnover at microtubule plus ends by interaction with microtubule-associated protein ATIP3.
25885343 2015 MTUS1/ATIP3a down-regulation is associated with enhanced migration, invasion and poor prognosis in salivary adenoid cystic carcinoma.
24650297 2014 Loss of MTUS1/ATIP expression is associated with adverse outcome in advanced bladder carcinomas: data from a retrospective study.
24299308 2014 Loss of MTUS1 in gastric cancer promotes tumor growth and metastasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23396587 2013 ATIP3, a novel prognostic marker of breast cancer patient survival, limits cancer cell migration and slows metastatic progression by regulating microtubule dynamics.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22153618 2012 Down-regulation of tumor suppressor MTUS1/ATIP is associated with enhanced proliferation, poor differentiation and poor prognosis in oral tongue squamous cell carcinoma.
More...