Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.63
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.600 2.2e-08
astrocytic glioma -2.400 1.5e-03
Astrocytoma, Pilocytic -2.600 1.4e-13
atypical teratoid / rhabdoid tumor -1.900 4.2e-05
ependymoma -2.200 3.9e-02
facioscapulohumeral dystrophy -1.500 5.0e-02
glioblastoma -2.500 1.1e-10
group 3 medulloblastoma -1.900 1.1e-05
lung carcinoma 2.000 2.1e-34
malignant mesothelioma 1.500 1.2e-05
medulloblastoma, large-cell -2.300 1.5e-06
nephrosclerosis -1.659 1.6e-02
oligodendroglioma -1.600 2.2e-02
Pick disease -1.200 1.1e-03
primitive neuroectodermal tumor -2.200 2.1e-05
psoriasis 1.300 2.9e-11

Gene RIF (6)

AA Sequence

MSQLRLLPSRLGVQAARLLAAHDVPVFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSW      1 - 70
DSFFREASEEAFSGSAQPRPPSVVHESRSAVSSRTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIL     71 - 140
DADLDSFVPSDLITTIDKLAFYDLQEADLDKEFQLPTTTFIGGSENTLSLREIIRRLENTYCQHIGLEFM    141 - 210
FINDVEQCQWIRQKFETPGVMQFSSEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTI    211 - 280
IDKSSEMGIENVILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTN    281 - 350
RNITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT    351 - 420
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVV    421 - 490
DLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRS    491 - 560
KDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPEDMLTHIGSVASSVPLEDFKIHTGLSRILRGRA    561 - 630
DMTKNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPY    631 - 700
TVCNSSLSEYGVLGFELGYAMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGM    701 - 770
EGMGPEHSSARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPL    771 - 840
IIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAARAPEQVQRLIFCTGKVYYDLVKERSSQDLEEK    841 - 910
VAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFMTILRRARPIWYVGRDPAAAP    911 - 980
ATGNRNTHLVSLKKFLDTAFNLQAFEGKTF                                            981 - 1010
//

Text Mined References (17)

PMID Year Title