Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.63
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
nephrosclerosis -1.659 0.016
malignant mesothelioma 1.500 0.000
astrocytic glioma -2.400 0.001
ependymoma -2.200 0.039
oligodendroglioma -1.600 0.022
glioblastoma -2.800 0.000
sonic hedgehog group medulloblastoma -2.600 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -2.200 0.000
pediatric high grade glioma -2.800 0.000
pilocytic astrocytoma -2.600 0.000
lung carcinoma 2.000 0.000
Pick disease -1.200 0.001
psoriasis 1.300 0.000
facioscapulohumeral dystrophy -1.500 0.050

Synonym

Accession Q9ULD0 A8K2G1 B4DKG2 B4E193 Q8TAN9 Q9NVA0
Symbols

Gene

Gene RIF (6)

PMID Text
23152800 inactivation of OGDHL can contribute to cervical tumorigenesis via activation of the AKT signaling pathway and thus support it as an important anti-proliferative gene in cervical cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSQLRLLPSRLGVQAARLLAAHDVPVFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSW      1 - 70
DSFFREASEEAFSGSAQPRPPSVVHESRSAVSSRTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIL     71 - 140
DADLDSFVPSDLITTIDKLAFYDLQEADLDKEFQLPTTTFIGGSENTLSLREIIRRLENTYCQHIGLEFM    141 - 210
FINDVEQCQWIRQKFETPGVMQFSSEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTI    211 - 280
IDKSSEMGIENVILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTN    281 - 350
RNITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT    351 - 420
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVV    421 - 490
DLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRS    491 - 560
KDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPEDMLTHIGSVASSVPLEDFKIHTGLSRILRGRA    561 - 630
DMTKNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPY    631 - 700
TVCNSSLSEYGVLGFELGYAMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGM    701 - 770
EGMGPEHSSARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPL    771 - 840
IIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAARAPEQVQRLIFCTGKVYYDLVKERSSQDLEEK    841 - 910
VAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFMTILRRARPIWYVGRDPAAAP    911 - 980
ATGNRNTHLVSLKKFLDTAFNLQAFEGKTF                                            981 - 1010
//

Publication (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23152800 2012 OGDHL is a modifier of AKT-dependent signaling and NF-?B function.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
18004749 2008 Structure-function relationships in the 2-oxo acid dehydrogenase family: substrate-specific signatures and functional predictions for the 2-oxoglutarate dehydrogenase-like proteins.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...