Property Summary

NCBI Gene PubMed Count 27
PubMed Score 19.33
PubTator Score 23.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 2.7e-04
Astrocytoma, Pilocytic -1.100 2.9e-07
atypical teratoid / rhabdoid tumor -1.500 1.0e-10
ependymoma -1.100 7.8e-12
glioblastoma -1.300 3.3e-12
group 3 medulloblastoma -1.200 1.3e-03
medulloblastoma, large-cell -1.500 1.2e-04
osteosarcoma 2.001 1.9e-07
primitive neuroectodermal tumor -1.500 2.6e-05
tuberculosis 1.100 5.0e-07

Gene RIF (20)

AA Sequence

MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLANFSMATFMDP      1 - 70
GVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNC     71 - 140
IGRRNYRYFFLFLLSLSAHMVGVVAFGLVYVLNHAEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVL    141 - 210
VTRGRTTNEQVTGKFRGGVNPFTRGCCGNVEHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAP    211 - 280
LKVKLSDNGLKAGLGRSKSKGSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPP    281 - 350
TPAMYKFRPAFPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPL    351 - 420
SASDAFSGALRSLSLKASSRRGGDHVALQPLRSEGGPPTPHRSIFAPHALPNRNGSLSYDSLLNPGSPGG    421 - 490
HACPAHPAVGVAGYHSPYLHPGATGDPPRPLPRSFSPVLGPRPREPSPVRYDNLSRTIMASIQERKDREE    491 - 560
RERLLRSQADSLFGDSGVYDAPSSYSLQQASVLSEGPRGPALRYGSRDDLVAGPGFGGARNPALQTSLSS    561 - 630
LSSSVSRAPRTSSSSLQADQASSNAPGPRPSSGSHRSPARQGLPSPPGTPHSPSYAGPKAVAFIHTDLPE    631 - 700
PPPSLTVQRDHPQLKTPPSKLNGQSPGLARLGPATGPPGPSASPTRHTLVKKVSGVGGTTYEISV         701 - 765
//

Text Mined References (30)

PMID Year Title