Property Summary

NCBI Gene PubMed Count 27
Grant Count 1
R01 Count 1
Funding $68,250
PubMed Score 18.83
PubTator Score 23.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 2.001 0.000
ependymoma -1.100 0.000
glioblastoma -1.400 0.000
medulloblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.500 0.000
tuberculosis 1.100 0.000
pediatric high grade glioma -1.200 0.000
pilocytic astrocytoma -1.100 0.000

Synonym

Accession Q9ULC8 Q2TGE9 Q6ICL1 Q6ZNF5 Q7Z6L9
Symbols DHHC8
ZNF378
ZDHHCL1

Gene

 Grant Application (1)

Gene RIF (20)

PMID Text
23403413 These data suggest that ZDHHC8 may play a role in cortical volumes in patients with schizophrenia.
22763378 increased corpus callosum volume in children with 22q11DS is associated with ZDHHC8 polymorphism.
20661937 Consistently negative associations with schizophrenia were found in the rs175174 polymorphism
20661937 Meta-analysis of gene-disease association. (HuGE Navigator)
20468065 The present study provides the first evidence that ZDHHC8 polymorphisms on the 22q11 locus are associated with smooth pursuit eye movement (SPEM)abnormality in a Korean population.
20468065 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
19801377 Data show that palmitoyl acyltransferases DHHC5, DHHC6, and DHHC8 appear to be S-acylated on three cysteine residues within a novel CCX(7-13)C(S/T) motif downstream of a conserved Asp-His-His-Cys cysteine-rich domain.
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLANFSMATFMDP      1 - 70
GVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNC     71 - 140
IGRRNYRYFFLFLLSLSAHMVGVVAFGLVYVLNHAEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVL    141 - 210
VTRGRTTNEQVTGKFRGGVNPFTRGCCGNVEHVLCSPLAPRYVVEPPRLPLAVSLKPPFLRPELLDRAAP    211 - 280
LKVKLSDNGLKAGLGRSKSKGSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPP    281 - 350
TPAMYKFRPAFPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPL    351 - 420
SASDAFSGALRSLSLKASSRRGGDHVALQPLRSEGGPPTPHRSIFAPHALPNRNGSLSYDSLLNPGSPGG    421 - 490
HACPAHPAVGVAGYHSPYLHPGATGDPPRPLPRSFSPVLGPRPREPSPVRYDNLSRTIMASIQERKDREE    491 - 560
RERLLRSQADSLFGDSGVYDAPSSYSLQQASVLSEGPRGPALRYGSRDDLVAGPGFGGARNPALQTSLSS    561 - 630
LSSSVSRAPRTSSSSLQADQASSNAPGPRPSSGSHRSPARQGLPSPPGTPHSPSYAGPKAVAFIHTDLPE    631 - 700
PPPSLTVQRDHPQLKTPPSKLNGQSPGLARLGPATGPPGPSASPTRHTLVKKVSGVGGTTYEISV         701 - 765
//

Publication (30)

PMID Year Title
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
23403413 2013 ZDHHC8 gene may play a role in cortical volumes of patients with schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
22763378 2012 Increased corpus callosum volume in children with chromosome 22q11.2 deletion syndrome is associated with neurocognitive deficits and genetic polymorphisms.
20661937 2010 Testing for genetic association between the ZDHHC8 gene locus and susceptibility to schizophrenia: An integrated analysis of multiple datasets.
20468065 2010 Association of ZDHHC8 polymorphisms with smooth pursuit eye movement abnormality.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19801377 2010 Proteome scale characterization of human S-acylated proteins in lipid raft-enriched and non-raft membranes.
19556522 2009 Palmitoylation of ATP-binding cassette transporter A1 is essential for its trafficking and function.
More...