Property Summary

NCBI Gene PubMed Count 23
Grant Count 90
R01 Count 73
Funding $8,763,990.17
PubMed Score 4.88
PubTator Score 12.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
Waldenstrons macroglobulinemia 1.420 0.003
Multiple myeloma 1.543 0.002
astrocytic glioma -1.600 0.023
osteosarcoma -1.623 0.000
non-small cell lung cancer 1.035 0.000
lung cancer 1.600 0.000
ovarian cancer 2.300 0.000

Synonym

Accession Q9ULC4 B4DGY2 Q502X6 MCT-1
Symbols MCT1
MCT-1

Gene

PANTHER Protein Class (1)

PDB

3R90  

Gene RIF (10)

PMID Text
23258846 Overexpression of MCT1 is associated with gliomas.
22336915 MCT-1 is a new centrosomal-associated oncoprotein, and that it plays a novel role in the regulation of mitosis signifies its important function in the process of tumorigenesis.
21138557 The oppositions between MCT-1 and p53 are firstly confirmed at multistage processes that include transcription control, mRNA metabolism, and protein expression
20823576 The present study indicates possible involvement of a protein kinase (PK)C- and PKA-mediated pathway associated with expression of MCT1 and lactate transport in rhabdomyosarcoma cells.
20658178 The result suggest that co-expression of CD147 and MCT1/MCT4 is related to drug resistance during EOC metastasis and could be useful therapeutic targets to prevent the development of incurable, recurrent and drug resistance EOC.
20076993 Results describe the expression and purification of MCT-1 in insect cells using a baculovirus expression system.
19372582 Loss of p53 and MCT-1 overexpression synergistically promote chromosome instability and tumorigenicity.
18824261 role of the MCT-1 in lymphomagenesis
12938157 demonstrated the presence of sequence-specific DNA-binding protein in nuclear extracts designated as LMBF; the 26-mer oligonucleotide containing the LMBF binding site is required for maximum transcriptional activity of the MCT-1 promoter
12637315 tumor cell lines overexpressing MCT-1 exhibited increased growth rates and displayed increased protection against apoptosis induced by serum starvation

AA Sequence

MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLF      1 - 70
FRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQ     71 - 140
HALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK                                 141 - 181
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25043021 2014 DENR-MCT-1 promotes translation re-initiation downstream of uORFs to control tissue growth.
23258846 2013 Monocarboxylate transporters (MCTs) in gliomas: expression and exploitation as therapeutic targets.
22336915 2012 The involvement of MCT-1 oncoprotein in inducing mitotic catastrophe and nuclear abnormalities.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21138557 2010 The antagonism between MCT-1 and p53 affects the tumorigenic outcomes.
20823576 2010 Regulation of monocarboxylate transporter 1 in skeletal muscle cells by intracellular signaling pathways.
20713520 2010 Activities of Ligatin and MCT-1/DENR in eukaryotic translation initiation and ribosomal recycling.
20658178 2010 Co-expression of CD147/EMMPRIN with monocarboxylate transporters and multiple drug resistance proteins is associated with epithelial ovarian cancer progression.
More...