Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.89
PubTator Score 12.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.600 2.3e-02
hepatocellular carcinoma 1.100 2.0e-06
lung cancer 1.600 2.6e-04
Multiple myeloma 1.543 1.6e-03
non-small cell lung cancer 1.035 6.2e-17
osteosarcoma -1.623 8.7e-06
ovarian cancer -1.100 4.7e-03
Waldenstrons macroglobulinemia 1.420 2.5e-03

Gene RIF (12)

AA Sequence

MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLF      1 - 70
FRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQ     71 - 140
HALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK                                 141 - 181
//

Text Mined References (35)

PMID Year Title