Property Summary

NCBI Gene PubMed Count 28
Grant Count 10
R01 Count 5
Funding $1,149,285.8
PubMed Score 43.04
PubTator Score 28.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26648292 Rab23 enhance squamous cell carcinoma cell invasion via up-regulating Rac1.
26238143 Rab23 is expressed in breast cancer cells, and ectopic expression of Rab23 inhibits the growth and proliferation as well as induces cell apoptosis in breast cancer cells These effects may be due to the inhibition by Rab23 of Gli1 and Gli2 mRNA expression
25867419 Data indicate the essential role of GTP binding protein RAB 23 (Rab23) in pancreatic ductal adenocarcinoma (PDAC) inva-sion, motility and metastasis.
25489984 Rab23 was a target gene of miR-367, and ectopic expression of Rab23 could reverse the invasion and migration inhibitory activity of miR-367.
23948406 Rab23 expression level was the highest in Bcap-37 cells.
23007279 The inhibition of the Rab23 cycle decreases the expression and nuclear localization of Gli1.
22452336 Rab9A and Rab23 GTPases play crucial roles in autophagy of Group A Streptococcus.
22365972 Rab23 directly associates with Su(Fu) and inhibits Gli1 function in a Su(Fu)-dependent manner.
21540310 association of the 6p12.1 locus with sarcoidosis implicates this locus as a further susceptibility factor and RAB23 as a potential signalling component
21412941 Carpenter syndrome: extended RAB23 mutation spectrum and analysis of nonsense-mediated mRNA decay
More...

AA Sequence

MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEE      1 - 70
FDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALA     71 - 140
KRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLN    141 - 210
GGDVINLRPNKQRTKKNRNPFSSCSIP                                               211 - 237
//

Publication (32)

PMID Year Title
26648292 2015 [Rab23 enhances invasion of Sa3 cutaneous squamous cell carcinoma cells via up-regulating the expression of Rac1].
26238143 2015 Effect of Rab23 on the proliferation and apoptosis in breast cancer.
25867419 2015 Inactivation of Rab23 inhibits the invasion and motility of pancreatic duct adenocarcinoma.
25489984 2015 The microRNA-367 inhibits the invasion and metastasis of gastric cancer by directly repressing Rab23.
23948406 2013 [Role of Rab23 in invasion and migration of human breast cancer Bcap-37 cells].
23599695 2013 A Novel Aberrant Splice Site Mutation in RAB23 Leads to an Eight Nucleotide Deletion in the mRNA and Is Responsible for Carpenter Syndrome in a Consanguineous Emirati Family.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23007279 2012 Sublocalization of Rab23, a mediator of Sonic hedgehog signaling pathway, in hepatocellular carcinoma cell lines.
22724020 2012 Deregulation of Rab and Rab effector genes in bladder cancer.
More...