Property Summary

NCBI Gene PubMed Count 12
PubMed Score 23.37
PubTator Score 16.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.700 4.6e-05
Astrocytoma, Pilocytic -1.500 1.2e-06
atypical teratoid / rhabdoid tumor -1.300 8.4e-04
ependymoma -1.700 6.7e-10
glioblastoma -1.600 4.6e-08
group 4 medulloblastoma -1.800 1.2e-05
ovarian cancer -1.300 2.2e-04

Gene RIF (4)

AA Sequence

MKLGKVEFCHFLQLIALFLCFSGMSQAELSRSRSKPYFQSGRSRTKRSWVWNQFFVLEEYMGSDPLYVGK      1 - 70
LHSDVDKGDGSIKYILSGEGASSIFIIDENTGDIHATKRLDREEQAYYTLRAQALDRLTNKPVEPESEFV     71 - 140
IKIQDINDNEPKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQPYFSVEPKTGV    141 - 210
IKTALPNMDREAKDQYLLVIQAKDMVGQNGGLSGTTSVTVTLTDVNDNPPRFPRRSYQYNVPESLPVASV    211 - 280
VARIKAADADIGANAEMEYKIVDGDGLGIFKISVDKETQEGIITIQKELDFEAKTSYTLRIEAANKDADP    281 - 350
RFLSLGPFSDTTTVKIIVEDVDEPPVFSSPLYPMEVSEATQVGNIIGTVAAHDPDSSNSPVRYSIDRNTD    351 - 420
LERYFNIDANSGVITTAKSLDRETNAIHNITVLAMESQNPSQVGRGYVAITILDINDNAPEFAMDYETTV    421 - 490
CENAQPGQVIQKISAVDKDEPSNGHQFYFSLTTDATNNHNFSLKDNKDNTASILTRRNGFRRQEQSVYYL    491 - 560
PIFIVDSGSPSLSSTNTLTIRVCDCDADGVAQTCNAEAYVLPAGLSTGALIAILACVLTLLVLILLIVTM    561 - 630
RRRKKEPLIFDEERDIRENIVRYDDEGGGEEDTEAFDMAALRNLNVIRDTKTRRDVTPEIQFLSRPAFKS    631 - 700
IPDNVIFREFIWERLKEADVDPGAPPYDSLQTYAFEGNGSVAESLSSLDSISSNSDQNYDYLSDWGPRFK    701 - 770
RLADMYGTGQESLYS                                                           771 - 785
//

Text Mined References (13)

PMID Year Title