Property Summary

NCBI Gene PubMed Count 12
Grant Count 7
R01 Count 4
Funding $792,743.67
PubMed Score 22.79
PubTator Score 16.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma -1.900 0.000
glioblastoma -1.600 0.000
group 4 medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.300 0.001
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -1.500 0.000
ovarian cancer -1.300 0.000

Gene RIF (4)

PMID Text
24554215 Our results support CDH7 to be a risk factor of major depressive disorder in the Han Chinese population
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19200257 Cadherin-7 interacts with melanoma inhibitory activity protein and negatively modulates melanoma cell migration.
15273735 During oncogenesis, cadherin-7, N-cad and E-cad could be used as an efficient marker set for melanoma.

AA Sequence

MKLGKVEFCHFLQLIALFLCFSGMSQAELSRSRSKPYFQSGRSRTKRSWVWNQFFVLEEYMGSDPLYVGK      1 - 70
LHSDVDKGDGSIKYILSGEGASSIFIIDENTGDIHATKRLDREEQAYYTLRAQALDRLTNKPVEPESEFV     71 - 140
IKIQDINDNEPKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQPYFSVEPKTGV    141 - 210
IKTALPNMDREAKDQYLLVIQAKDMVGQNGGLSGTTSVTVTLTDVNDNPPRFPRRSYQYNVPESLPVASV    211 - 280
VARIKAADADIGANAEMEYKIVDGDGLGIFKISVDKETQEGIITIQKELDFEAKTSYTLRIEAANKDADP    281 - 350
RFLSLGPFSDTTTVKIIVEDVDEPPVFSSPLYPMEVSEATQVGNIIGTVAAHDPDSSNSPVRYSIDRNTD    351 - 420
LERYFNIDANSGVITTAKSLDRETNAIHNITVLAMESQNPSQVGRGYVAITILDINDNAPEFAMDYETTV    421 - 490
CENAQPGQVIQKISAVDKDEPSNGHQFYFSLTTDATNNHNFSLKDNKDNTASILTRRNGFRRQEQSVYYL    491 - 560
PIFIVDSGSPSLSSTNTLTIRVCDCDADGVAQTCNAEAYVLPAGLSTGALIAILACVLTLLVLILLIVTM    561 - 630
RRRKKEPLIFDEERDIRENIVRYDDEGGGEEDTEAFDMAALRNLNVIRDTKTRRDVTPEIQFLSRPAFKS    631 - 700
IPDNVIFREFIWERLKEADVDPGAPPYDSLQTYAFEGNGSVAESLSSLDSISSNSDQNYDYLSDWGPRFK    701 - 770
RLADMYGTGQESLYS                                                           771 - 785
//

Publication (13)

PMID Year Title
24554215 2014 Common variants in the CDH7 gene are associated with major depressive disorder in the Han Chinese population.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
22765916 2012 Cadherins and neuropsychiatric disorders.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19200257 2009 Cadherin-7 interacts with melanoma inhibitory activity protein and negatively modulates melanoma cell migration.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15273735 2004 Involvement of cadherins 7 and 20 in mouse embryogenesis and melanocyte transformation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10995570 2000 Characterization of three novel human cadherin genes (CDH7, CDH19, and CDH20) clustered on chromosome 18q22-q23 and with high homology to chicken cadherin-7.
More...