Property Summary

NCBI Gene PubMed Count 12
PubMed Score 22.79
PubTator Score 16.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Colorectal Neoplasms 217
Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.56593590890039E-11
glioblastoma 5572 4.59064260815871E-8
pilocytic astrocytoma 3086 1.08751490131478E-6
group 4 medulloblastoma 1875 1.15360420793597E-5
adult high grade glioma 2148 4.59935161137902E-5
ovarian cancer 8492 2.22486928053378E-4
atypical teratoid / rhabdoid tumor 4369 8.44007872945067E-4
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Systemic scleroderma 66 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma -1.900 0.000
glioblastoma -1.600 0.000
group 4 medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.300 0.001
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -1.500 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q9ULB5 Q9H157
Symbols CDH7L1

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Gene RIF (4)

PMID Text
24554215 Our results support CDH7 to be a risk factor of major depressive disorder in the Han Chinese population
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19200257 Cadherin-7 interacts with melanoma inhibitory activity protein and negatively modulates melanoma cell migration.
15273735 During oncogenesis, cadherin-7, N-cad and E-cad could be used as an efficient marker set for melanoma.

AA Sequence

MKLGKVEFCHFLQLIALFLCFSGMSQAELSRSRSKPYFQSGRSRTKRSWVWNQFFVLEEYMGSDPLYVGK      1 - 70
LHSDVDKGDGSIKYILSGEGASSIFIIDENTGDIHATKRLDREEQAYYTLRAQALDRLTNKPVEPESEFV     71 - 140
IKIQDINDNEPKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQPYFSVEPKTGV    141 - 210
IKTALPNMDREAKDQYLLVIQAKDMVGQNGGLSGTTSVTVTLTDVNDNPPRFPRRSYQYNVPESLPVASV    211 - 280
VARIKAADADIGANAEMEYKIVDGDGLGIFKISVDKETQEGIITIQKELDFEAKTSYTLRIEAANKDADP    281 - 350
RFLSLGPFSDTTTVKIIVEDVDEPPVFSSPLYPMEVSEATQVGNIIGTVAAHDPDSSNSPVRYSIDRNTD    351 - 420
LERYFNIDANSGVITTAKSLDRETNAIHNITVLAMESQNPSQVGRGYVAITILDINDNAPEFAMDYETTV    421 - 490
CENAQPGQVIQKISAVDKDEPSNGHQFYFSLTTDATNNHNFSLKDNKDNTASILTRRNGFRRQEQSVYYL    491 - 560
PIFIVDSGSPSLSSTNTLTIRVCDCDADGVAQTCNAEAYVLPAGLSTGALIAILACVLTLLVLILLIVTM    561 - 630
RRRKKEPLIFDEERDIRENIVRYDDEGGGEEDTEAFDMAALRNLNVIRDTKTRRDVTPEIQFLSRPAFKS    631 - 700
IPDNVIFREFIWERLKEADVDPGAPPYDSLQTYAFEGNGSVAESLSSLDSISSNSDQNYDYLSDWGPRFK    701 - 770
RLADMYGTGQESLYS                                                           771 - 785
//

Text Mined References (13)

PMID Year Title
24554215 2014 Common variants in the CDH7 gene are associated with major depressive disorder in the Han Chinese population.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
22765916 2012 Cadherins and neuropsychiatric disorders.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19200257 2009 Cadherin-7 interacts with melanoma inhibitory activity protein and negatively modulates melanoma cell migration.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15273735 2004 Involvement of cadherins 7 and 20 in mouse embryogenesis and melanocyte transformation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10995570 2000 Characterization of three novel human cadherin genes (CDH7, CDH19, and CDH20) clustered on chromosome 18q22-q23 and with high homology to chicken cadherin-7.
More...