Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.77
PubTator Score 8.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.100 2.6e-02
astrocytic glioma -1.900 2.9e-03
Astrocytoma, Pilocytic -1.500 1.5e-05
atypical teratoid / rhabdoid tumor -1.600 4.8e-03
ependymoma -2.300 2.8e-03
glioblastoma -1.200 1.1e-05
group 4 medulloblastoma -1.300 8.8e-03
lung carcinoma 3.300 1.3e-13
medulloblastoma, large-cell -2.100 1.6e-03
oligodendroglioma -2.000 4.5e-03
primitive neuroectodermal tumor -1.400 1.4e-02

Gene RIF (4)

AA Sequence

MRTYHYIPLFIWTYMFHTVDTILLQEKPNSYLSSKKIAGLTKDDGKMLRRTKRGWMWNQFFLLEEYTGTD      1 - 70
TQYVGKLHTDQDKGDGNLKYILTGDGAGSLFVIDENTGDIHAAKKLDREEKSLYILRAKAIDRKTGRQVE     71 - 140
PESEFIIKIHDINDNEPKFTKDLYTASVPEMSGVGTSVIQVTATDADDANYGNSAKVVYSILQGQPYFSV    141 - 210
DPESGIIKTALPDMSRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNNNPPRFPQSTYQFNSPES    211 - 280
VPLGTHLGRIKANDPDVGENAEMEYSIAEGDGADMFDVITDKDTQEGIITVKQNLDFENQMLYTLRVDAS    281 - 350
NTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYS    351 - 420
VDRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSHIPVFIRILDINDHAPEFAM    421 - 490
YYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVDNKDNTAGIMTRKDGYSRNK    491 - 560
MSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSCTAEALILSAGLSTGALVAILLCVLILLILV    561 - 630
VLFAALKRQRKKEPLIISKDDVRDNIVTYNDEGGGEEDTQAFDIGTLRNPEAREDSKLRRDVMPETIFQI    631 - 700
RRTVPLWENIDVQDFIHRRLKENDADPSAPPYDSLATYAYEGNDSIADSLSSLESLTADCNQDYDYLSDW    701 - 770
GPRFKKLADMYGGDDSDRD                                                       771 - 789
//

Text Mined References (15)

PMID Year Title