Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
Funding $90,273
PubMed Score 6.98
PubTator Score 8.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.900 0.003
ependymoma -2.300 0.003
oligodendroglioma -2.000 0.004
glioblastoma -2.100 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.600 0.005
medulloblastoma, large-cell -2.100 0.002
primitive neuroectodermal tumor -1.400 0.014
pediatric high grade glioma -1.400 0.000
pilocytic astrocytoma -1.500 0.000
lung carcinoma 3.300 0.000

Synonym

Accession Q9ULB4 Q3B7I5
Symbols

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (4)

PMID Text
22846907 The CC genotype of rs4307059 located in the region between CDH9 and CDH10 is associated with completed suicide in a Polish cohort
21079607 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19404256 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17668045 Cadherin-9 is a reliable cell surface marker for fibroblasts in healthy and diseased kidneys.

AA Sequence

MRTYHYIPLFIWTYMFHTVDTILLQEKPNSYLSSKKIAGLTKDDGKMLRRTKRGWMWNQFFLLEEYTGTD      1 - 70
TQYVGKLHTDQDKGDGNLKYILTGDGAGSLFVIDENTGDIHAAKKLDREEKSLYILRAKAIDRKTGRQVE     71 - 140
PESEFIIKIHDINDNEPKFTKDLYTASVPEMSGVGTSVIQVTATDADDANYGNSAKVVYSILQGQPYFSV    141 - 210
DPESGIIKTALPDMSRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNNNPPRFPQSTYQFNSPES    211 - 280
VPLGTHLGRIKANDPDVGENAEMEYSIAEGDGADMFDVITDKDTQEGIITVKQNLDFENQMLYTLRVDAS    281 - 350
NTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYS    351 - 420
VDRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSHIPVFIRILDINDHAPEFAM    421 - 490
YYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVDNKDNTAGIMTRKDGYSRNK    491 - 560
MSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSCTAEALILSAGLSTGALVAILLCVLILLILV    561 - 630
VLFAALKRQRKKEPLIISKDDVRDNIVTYNDEGGGEEDTQAFDIGTLRNPEAREDSKLRRDVMPETIFQI    631 - 700
RRTVPLWENIDVQDFIHRRLKENDADPSAPPYDSLATYAYEGNDSIADSLSSLESLTADCNQDYDYLSDW    701 - 770
GPRFKKLADMYGGDDSDRD                                                       771 - 789
//

Text Mined References (15)

PMID Year Title
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23279374 2013 Genetic determinants of plasma ??-glycoprotein I levels: a genome-wide association study in extended pedigrees from Spain.
22872573 2012 Genome-wide association study of prognosis in advanced non-small cell lung cancer patients receiving platinum-based chemotherapy.
22846907 2012 Analysis of four genes involved in the neurodevelopment shows association of rs4307059 polymorphism in the cadherin 9/10 region with completed suicide.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
19404256 2009 Common genetic variants on 5p14.1 associate with autism spectrum disorders.
17668045 2007 Cadherin-9 is a novel cell surface marker for the heterogeneous pool of renal fibroblasts.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...