Property Summary

Ligand Count 3
NCBI Gene PubMed Count 20
PubMed Score 32.93
PubTator Score 9.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.1e-05
medulloblastoma, large-cell 6241 1.3e-03
adult high grade glioma 3801 2.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Goodpasture syndrome 6 3.206 1.6
Tonsillitis 16 3.136 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma 1.100 2.5e-03
medulloblastoma, large-cell 1.400 1.3e-03
ovarian cancer 1.400 5.1e-05

Gene RIF (3)

AA Sequence

MQVAMNGKARKEAVQTAAKELLKFVNRSPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNS      1 - 70
STIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRV     71 - 140
IVKCPTSGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGPLN    141 - 210
AVDERHHSVLMSLLCAHLGLSPKDIVEMELCLADTQPAVLGGAYDEFIFAPRLDNLHSCFCALQALIDSC    211 - 280
AGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRISASCQHPTAFEEAIPKSFMISADMAHA    281 - 350
VHPNYLDKHEENHRPLFHKGPVIKVNSKQRYASNAVSEALIREVANKVKVPLQDLMVRNDTPCGTTIGPI    351 - 420
LASRLGLRVLDLGSPQLAMHSIREMACTTGVLQTLTLFKGFFELFPSLSHNLLVD                   421 - 475
//

Text Mined References (24)

PMID Year Title