Property Summary

NCBI Gene PubMed Count 22
Grant Count 15
R01 Count 6
Funding $2,609,635.97
PubMed Score 24.77
PubTator Score 26.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -4.600 0.000
posterior fossa group A ependymoma -6.500 0.000
glioblastoma -5.600 0.000
oligodendroglioma -2.700 0.000
sonic hedgehog group medulloblastoma -2.200 0.007
atypical teratoid / rhabdoid tumor -6.100 0.000
medulloblastoma, large-cell -3.000 0.000
pediatric high grade glioma -5.100 0.000
pilocytic astrocytoma -5.300 0.000
subependymal giant cell astrocytoma -4.682 0.034
lung carcinoma 3.100 0.000
Pick disease -1.800 0.014
pituitary cancer 1.100 0.013

Gene RIF (13)

PMID Text
25232846 Our data strongly strengthen the hypothesis that MYT1L is the causal gene for the observed syndromal intellectual disability.
24820620 Report shows that the first histidine of Cys2His2Cys domains is involved in a functionally important hydrogen bonding interaction.
24015200 MYT1L rs17039396 variants are associated with clinical outcome in gastric cancer.
23918370 Data indicate that reintroduction of A2BP1 or Myt1L in glioblastoma multiforme (GBM) cell lines and glioma stem cells profoundly inhibited tumorigenesis.
23061379 MYT1L and the SNTG2 genes within the reported region could probably relate to the phenotypic discordance of the monozygotic twins.
22547139 A meta-analysis of four recently published studies that together provide strong evidence for an association between variably sized microduplications involving the MYT1L gene and schizophrenia.
22157634 Results from this study indicate that the 2p25.3 duplication disrupting PXDN and MYT1L is a potential autism-causing variant in the pedigree reported here and should receive further consideration as a candidate for autism
21990140 MYT1L deletion gives a nonspecific clinical phenotype shared by patients with 2p25.3 deletions, with only intellectual disability and obesity/overweight being present in all patients.
21923761 Findings suggest that MYT1L may represent a susceptibility gene for schizophrenia in the Han Chinese population and show that a specific SNP may increase susceptibility in females.
21048971 results indicate that MYT1L may be a potential risk gene for major depressive disorder in the Chinese Han population
More...

AA Sequence

MEVDTEEKRHRTRSKGVRVPVEPAIQELFSCPTPGCDGSGHVSGKYARHRSVYGCPLAKKRKTQDKQPQE      1 - 70
PAPKRKPFAVKADSSSVDECDDSDGTEDMDEKEEDEGEEYSEDNDEPGDEDEEDEEGDREEEEEIEEEDE     71 - 140
DDDEDGEDVEDEEEEEEEEEEEEEEEENEDHQMNCHNTRIMQDTEKDDNNNDEYDNYDELVAKSLLNLGK    141 - 210
IAEDAAYRARTESEMNSNTSNSLEDDSDKNENLGRKSELSLDLDSDVVRETVDSLKLLAQGHGVVLSENM    211 - 280
NDRNYADSMSQQDSRNMNYVMLGKPMNNGLMEKMVEESDEEVCLSSLECLRNQCFDLARKLSETNPQERN    281 - 350
PQQNMNIRQHVRPEEDFPGRTPDRNYSDMLNLMRLEEQLSPRSRVFASCAKEDGCHERDDDTTSVNSDRS    351 - 420
EEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKPKSSDSHVKKP    421 - 490
YYGKDPSRTEKKESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHESVLKCPTPGCTGRGH    491 - 560
VNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSSQASDRVLRPMCFVKQLEIPQYGYRNNVPTTTP    561 - 630
RSNLAKELEKYSKTSFEYNSYDNHTYGKRAIAPKVQTRDISPKGYDDAKRYCKDPSPSSSSTSSYAPSSS    631 - 700
SNLSCGGGSSASSTCSKSSFDYTHDMEAAHMAATAILNLSTRCREMPQNLSTKPQDLCATRNPDMEVDEN    701 - 770
GTLDLSMNKQRPRDSCCPILTPLEPMSPQQQAVMNNRCFQLGEGDCWDLPVDYTKMKPRRIDEDESKDIT    771 - 840
PEDLDPFQEALEERRYPGEVTIPSPKPKYPQCKESKKDLITLSGCPLADKSIRSMLATSSQELKCPTPGC    841 - 910
DGSGHITGNYASHRSLSGCPRAKKSGIRIAQSKEDKEDQEPIRCPVPGCDGQGHITGKYASHRSASGCPL    911 - 980
AAKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVSGSFLTHRSLSGCPRATSAMKKAKLSGEQMLT    981 - 1050
IKQRASNGIENDEEIKQLDEEIKELNESNSQMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHE   1051 - 1120
LANLSQSLIHSLANIQLPHMDPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV       1121 - 1186
//

Text Mined References (25)

PMID Year Title
25232846 2015 Refinement of the critical 2p25.3 deletion region: the role of MYT1L in intellectual disability and obesity.
25147783 2014 Genetic Associations with Plasma B12, B6, and Folate Levels in an Ischemic Stroke Population from the Vitamin Intervention for Stroke Prevention (VISP) Trial.
24820620 2014 A role for hydrogen bonding in DNA recognition by the non-classical CCHHC type zinc finger, NZF-1.
24015200 2013 Clinical significance of MYT1L gene polymorphisms in Chinese patients with gastric cancer.
23918370 2013 From the Cover: Neutralization of terminal differentiation in gliomagenesis.
23160955 2012 Multiplex targeted sequencing identifies recurrently mutated genes in autism spectrum disorders.
23061379 2013 Monozygotic twins discordant for submicroscopic chromosomal anomalies in 2p25.3 region detected by array CGH.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22547139 2012 Microduplications disrupting the MYT1L gene (2p25.3) are associated with schizophrenia.
22157634 2012 Germline mosaic transmission of a novel duplication of PXDN and MYT1L to two male half-siblings with autism.
More...