Property Summary

NCBI Gene PubMed Count 24
PubMed Score 30.08
PubTator Score 26.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.500 5.5e-03
astrocytic glioma -2.500 7.4e-03
Astrocytoma, Pilocytic -2.600 5.1e-05
atypical teratoid / rhabdoid tumor -2.000 2.2e-04
ependymoma -2.700 9.0e-03
glioblastoma -2.300 3.8e-07
group 3 medulloblastoma 2.100 1.3e-05
lung carcinoma 3.100 1.1e-42
medulloblastoma, large-cell -3.000 3.5e-05
oligodendroglioma -2.500 1.5e-15
Pick disease -1.800 1.4e-02
pituitary cancer 1.100 1.3e-02
subependymal giant cell astrocytoma -3.045 3.3e-02

Gene RIF (15)

AA Sequence

MEVDTEEKRHRTRSKGVRVPVEPAIQELFSCPTPGCDGSGHVSGKYARHRSVYGCPLAKKRKTQDKQPQE      1 - 70
PAPKRKPFAVKADSSSVDECDDSDGTEDMDEKEEDEGEEYSEDNDEPGDEDEEDEEGDREEEEEIEEEDE     71 - 140
DDDEDGEDVEDEEEEEEEEEEEEEEEENEDHQMNCHNTRIMQDTEKDDNNNDEYDNYDELVAKSLLNLGK    141 - 210
IAEDAAYRARTESEMNSNTSNSLEDDSDKNENLGRKSELSLDLDSDVVRETVDSLKLLAQGHGVVLSENM    211 - 280
NDRNYADSMSQQDSRNMNYVMLGKPMNNGLMEKMVEESDEEVCLSSLECLRNQCFDLARKLSETNPQERN    281 - 350
PQQNMNIRQHVRPEEDFPGRTPDRNYSDMLNLMRLEEQLSPRSRVFASCAKEDGCHERDDDTTSVNSDRS    351 - 420
EEVFDMTKGNLTLLEKAIALETERAKAMREKMAMEAGRRDNMRSYEDQSPRQLPGEDRKPKSSDSHVKKP    421 - 490
YYGKDPSRTEKKESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHESVLKCPTPGCTGRGH    491 - 560
VNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSSQASDRVLRPMCFVKQLEIPQYGYRNNVPTTTP    561 - 630
RSNLAKELEKYSKTSFEYNSYDNHTYGKRAIAPKVQTRDISPKGYDDAKRYCKDPSPSSSSTSSYAPSSS    631 - 700
SNLSCGGGSSASSTCSKSSFDYTHDMEAAHMAATAILNLSTRCREMPQNLSTKPQDLCATRNPDMEVDEN    701 - 770
GTLDLSMNKQRPRDSCCPILTPLEPMSPQQQAVMNNRCFQLGEGDCWDLPVDYTKMKPRRIDEDESKDIT    771 - 840
PEDLDPFQEALEERRYPGEVTIPSPKPKYPQCKESKKDLITLSGCPLADKSIRSMLATSSQELKCPTPGC    841 - 910
DGSGHITGNYASHRSLSGCPRAKKSGIRIAQSKEDKEDQEPIRCPVPGCDGQGHITGKYASHRSASGCPL    911 - 980
AAKRQKDGYLNGSQFSWKSVKTEGMSCPTPGCDGSGHVSGSFLTHRSLSGCPRATSAMKKAKLSGEQMLT    981 - 1050
IKQRASNGIENDEEIKQLDEEIKELNESNSQMEADMIKLRTQITTMESNLKTIEEENKVIEQQNESLLHE   1051 - 1120
LANLSQSLIHSLANIQLPHMDPINEQNFDAYVTTLTEMYTNQDRYQSPENKALLENIKQAVRGIQV       1121 - 1186
//

Text Mined References (27)

PMID Year Title