Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.15
PubTator Score 5.31

Knowledge Summary


No data available


  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 2.700 0.020
ependymoma 2.900 0.004
oligodendroglioma 2.500 0.003
glioblastoma multiforme 1.200 0.000
osteosarcoma -2.265 0.000
medulloblastoma, large-cell -1.300 0.000
acute quadriplegic myopathy 1.492 0.000
primary pancreatic ductal adenocarcinoma 1.166 0.004
tuberculosis and treatment for 3 months -1.600 0.000
group 3 medulloblastoma 1.400 0.018
pilocytic astrocytoma 1.100 0.002
Pick disease 1.300 0.001
ovarian cancer -1.900 0.000
pancreatic cancer 1.100 0.007

Gene RIF (3)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18710924 These novel findings identify a role for muskelin-RanBP9 complex in pathways that integrate cell morphology regulation and nucleocytoplasmic communication.
17467196 RanBPM, ARMC8alpha, ARMC8beta, Muskelin, p48EMLP, and p44CTLH form complexes in cells

AA Sequence

DHTYAQRTQLFDTLVNFFPDSMTPPKGNLVDLITL                                       701 - 735

Text Mined References (23)

PMID Year Title
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20038947 2011 Novel loci for major depression identified by genome-wide association study of Sequenced Treatment Alternatives to Relieve Depression and meta-analysis of three studies.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18710924 2008 Novel role of the muskelin-RanBP9 complex as a nucleocytoplasmic mediator of cell morphology regulation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.