Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.15
PubTator Score 5.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
glioblastoma multiforme 347 3.4431103524308E-19
ovarian cancer 8492 3.48519943827118E-12
acute quadriplegic myopathy 1157 1.13730321301778E-6
tuberculosis and treatment for 3 months 327 6.69872549322747E-6
osteosarcoma 7933 1.03490912622068E-5
medulloblastoma, large-cell 6234 8.5892195273117E-5
Pick disease 1893 0.00130722563821194
pilocytic astrocytoma 3086 0.00150433110807229
oligodendroglioma 2849 0.00336944903457343
primary pancreatic ductal adenocarcinoma 1271 0.00355681402076955
ependymoma 2514 0.00415708424916374
pancreatic cancer 2300 0.00673934766916386
group 3 medulloblastoma 2254 0.0176653947155977
astrocytic glioma 2241 0.0197213678370734
Disease Target Count Z-score Confidence
Mental depression 58 0.0 1.0
Disease Target Count Z-score Confidence
Lissencephaly 61 4.344 2.2
Ocular albinism 29 3.515 1.8

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 2.700 0.020
ependymoma 2.900 0.004
oligodendroglioma 2.500 0.003
glioblastoma multiforme 1.200 0.000
osteosarcoma -2.265 0.000
medulloblastoma, large-cell -1.300 0.000
acute quadriplegic myopathy 1.492 0.000
primary pancreatic ductal adenocarcinoma 1.166 0.004
tuberculosis and treatment for 3 months -1.600 0.000
group 3 medulloblastoma 1.400 0.018
pilocytic astrocytoma 1.100 0.002
Pick disease 1.300 0.001
ovarian cancer -1.900 0.000
pancreatic cancer 1.100 0.007

Synonym

Accession Q9UL63 A4D1M8 A6NG43 Q9NSK4 Q9NUS8
Symbols TWA2

Gene

  Ortholog (12)

Pathway (1)

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18710924 These novel findings identify a role for muskelin-RanBP9 complex in pathways that integrate cell morphology regulation and nucleocytoplasmic communication.
17467196 RanBPM, ARMC8alpha, ARMC8beta, Muskelin, p48EMLP, and p44CTLH form complexes in cells

AA Sequence

MAAGGAVAAAPECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLILKLERPAIVQN      1 - 70
ITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDEQMFPCRFIKIVPLLSWG     71 - 140
PSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHNYTEAFESLQKKTKIALEHPMLT    141 - 210
DIHDKLVLKGDFDACEELIEKAVNDGLFNQYISQQEYKPRWSQIIPKSTKGDGEDNRPGMRGGHQMVIDV    211 - 280
QTETVYLFGGWDGTQDLADFWAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYLDSS    281 - 350
VRNSKSLKSDFYRYDIDTNTWMLLSEDTAADGGPKLVFDHQMCMDSEKHMIYTFGGRILTCNGSVDDSRA    351 - 420
SEPQFSGLFAFNCQCQTWKLLREDSCNAGPEDIQSRIGHCMLFHSKNRCLYVFGGQRSKTYLNDFFSYDV    421 - 490
DSDHVDIISDGTKKDSGMVPMTGFTQRATIDPELNEIHVLSGLSKDKEKREENVRNSFWIYDIVRNSWSC    491 - 560
VYKNDQAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDY    561 - 630
LLRHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDV    631 - 700
DHTYAQRTQLFDTLVNFFPDSMTPPKGNLVDLITL                                       701 - 735
//

Text Mined References (23)

PMID Year Title
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20038947 2011 Novel loci for major depression identified by genome-wide association study of Sequenced Treatment Alternatives to Relieve Depression and meta-analysis of three studies.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18710924 2008 Novel role of the muskelin-RanBP9 complex as a nucleocytoplasmic mediator of cell morphology regulation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...