Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.70
PubTator Score 5.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.145 2.4e-05
astrocytic glioma 2.700 2.0e-02
Astrocytoma, Pilocytic 1.100 1.6e-03
ependymoma 2.900 4.2e-03
glioblastoma multiforme 1.200 3.4e-19
group 3 medulloblastoma 1.400 1.8e-02
medulloblastoma, large-cell -1.300 8.6e-05
oligodendroglioma 2.500 3.4e-03
osteosarcoma -2.265 1.0e-05
ovarian cancer -1.900 3.5e-12
pancreatic cancer 1.100 6.7e-03
Pick disease 1.300 1.3e-03
primary pancreatic ductal adenocarcinoma 1.166 3.6e-03
tuberculosis -1.500 1.1e-06

Gene RIF (4)

AA Sequence

MAAGGAVAAAPECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLILKLERPAIVQN      1 - 70
ITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDEQMFPCRFIKIVPLLSWG     71 - 140
PSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHNYTEAFESLQKKTKIALEHPMLT    141 - 210
DIHDKLVLKGDFDACEELIEKAVNDGLFNQYISQQEYKPRWSQIIPKSTKGDGEDNRPGMRGGHQMVIDV    211 - 280
QTETVYLFGGWDGTQDLADFWAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYLDSS    281 - 350
VRNSKSLKSDFYRYDIDTNTWMLLSEDTAADGGPKLVFDHQMCMDSEKHMIYTFGGRILTCNGSVDDSRA    351 - 420
SEPQFSGLFAFNCQCQTWKLLREDSCNAGPEDIQSRIGHCMLFHSKNRCLYVFGGQRSKTYLNDFFSYDV    421 - 490
DSDHVDIISDGTKKDSGMVPMTGFTQRATIDPELNEIHVLSGLSKDKEKREENVRNSFWIYDIVRNSWSC    491 - 560
VYKNDQAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDY    561 - 630
LLRHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDV    631 - 700
DHTYAQRTQLFDTLVNFFPDSMTPPKGNLVDLITL                                       701 - 735
//

Text Mined References (25)

PMID Year Title