Property Summary

NCBI Gene PubMed Count 51
Grant Count 59
R01 Count 36
Funding $7,221,989.7
PubMed Score 159.70
PubTator Score 114.07

Knowledge Summary

Patent (7,327)

Expression

  Differential Expression (1)

Disease log2 FC p
group 4 medulloblastoma 1.100 0.022

Synonym

Accession Q9UL62 B2RP53 O75233 Q5JXY8 Q9Y514 TrpC5
Symbols TRP5
PPP1R159

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (36)

PMID Text
25579062 TrpC5 plays an important role in VEGF-mediated tumor angiogenesis, suggesting its potential clinical value for anti-angiogenesis therapy
25404731 Suppressing TrpC5 expression decreased nuclear beta-catenin accumulation, reduced the induction of ABCB1, and reversed 5-fluorouracil neoplastic resistance.
25140002 Clemizole exhibits a sixfold selectivity for TRPC5.
25085710 TRPC5 mRNA and protein levels were up-regulated in focal cortical dysplasia cortical lesions.
24733904 TrpC5-containing circulating extracellular vesicles may transfer chemoresistance.
24582564 Microvesicles from tumor cells transferred TrpC5 to endothelial cells, inducing the expression of P-glycoprotein by activation of the transcription factor NFATc3 (nuclear factor of activated T cells isoform c3).
24177920 these results suggest that hypoosmotic cell-swelling activates Gq-coupled receptors, which in turn enhance the activation of TRPC5 by regulating this channel membrane trafficking
24117252 Riluzole can activate TRPC5 heterologously expressed in HEK293 cells as well as those endogenously expressed in the U-87 glioblastoma cell line.
23677990 the S4-S5 linker is a critical constituent of TRPC4/C5 channel gating and that disturbance of its sequence allows channel opening independent of any sensor domain.
23121507 Data using recombinant proteins expressed in vascular endothelial cells suggest that SigmaR1 (sigma 1-type opioid receptor) is not involved in regulation of calcium signaling via TRPC5/TRPM3 (transient receptor potential cation channels C5/M3).
More...

AA Sequence

MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLG      1 - 70
RSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRRPSGEKQVPTLMMDTQFSEFT     71 - 140
PDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIA    141 - 210
LSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELD    211 - 280
PQKYHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLI    281 - 350
SPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIK    351 - 420
EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEALFAISNILSS    421 - 490
LRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIRCEK    491 - 560
QNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQL    561 - 630
IADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRRNLRSFT    631 - 700
ERNADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTHEGLTEENFKELKQDISSFRYEVLDLLGNRKHPRSF    701 - 770
STSSTELSQRDDNNDGSGGARAKSKSVSFNLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGP    771 - 840
SLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEINLSEVELGEVQ    841 - 910
GAAQSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHKWGDGQEEQVTTRL           911 - 973
//

Publication (56)

PMID Year Title
25579062 2015 Enhancement of vascular endothelial growth factor release in long-term drug-treated breast cancer via transient receptor potential channel 5-Ca(2+)-hypoxia-inducible factor 1? pathway.
25404731 2015 Inhibition of transient receptor potential channel 5 reverses 5-Fluorouracil resistance in human colorectal cancer cells.
25140002 2014 Clemizole hydrochloride is a novel and potent inhibitor of transient receptor potential channel TRPC5.
25085710 2015 Increased expression of TRPC5 in cortical lesions of the focal cortical dysplasia.
24733904 2014 Essential role for TrpC5-containing extracellular vesicles in breast cancer with chemotherapeutic resistance.
24582564 2014 Tumor endothelial expression of P-glycoprotein upon microvesicular transfer of TrpC5 derived from adriamycin-resistant breast cancer cells.
24177920 2014 G protein-coupled receptor signalling potentiates the osmo-mechanical activation of TRPC5 channels.
24117252 2014 Riluzole activates TRPC5 channels independently of PLC activity.
23677990 2013 Conserved gating elements in TRPC4 and TRPC5 channels.
23121507 2013 Inhibition of endothelial cell Ca²? entry and transient receptor potential channels by Sigma-1 receptor ligands.
More...