Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.69
PubTator Score 5.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 7.5e-05
ependymoma 1.200 1.7e-08
group 4 medulloblastoma 1.300 6.0e-05
malignant mesothelioma -1.200 1.0e-05
medulloblastoma, large-cell 1.400 1.9e-04
non primary Sjogren syndrome sicca -1.200 2.7e-02

Gene RIF (1)

AA Sequence

MAVTFEDVTIIFTWEEWKFLDSSQKRLYREVMWENYTNVMSVENWNESYKSQEEKFRYLEYENFSYWQGW      1 - 70
WNAGAQMYENQNYGETVQGTDSKDLTQQDRSQCQEWLILSTQVPGYGNYELTFESKSLRNLKYKNFMPWQ     71 - 140
SLETKTTQDYGREIYMSGSHGFQGGRYRLGISRKNLSMEKEQKLIVQHSYIPVEEALPQYVGVICQEDLL    141 - 210
RDSMEEKYCGCNKCKGIYYWNSRCVFHKRNQPGENLCQCSICKACFSQRSDLYRHPRNHIGKKLYGCDEV    211 - 280
DGNFHQSSGVHFHQRVHIGEVPYSCNACGKSFSQISSLHNHQRVHTEEKFYKIECDKDLSRNSLLHIHQR    281 - 350
LHIGEKPFKCNQCGKSFNRSSVLHVHQRVHTGEKPYKCDECGKGFSQSSNLRIHQLVHTGEKSYKCEDCG    351 - 420
KGFTQRSNLQIHQRVHTGEKPYKCDDCGKDFSHSSDLRIHQRVHTGEKPYTCPECGKGFSKSSKLHTHQR    421 - 490
VHTGEKPYKCEECGKGFSQRSHLLIHQRVHTGEKPYKCHDCGKGFSHSSNLHIHQRVHTGEKPYQCAKCG    491 - 560
KGFSHSSALRIHQRVHAGEKPYKCREYYKGFDHNSHLHNNHRRGNL                            561 - 606
//

Text Mined References (12)

PMID Year Title