Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.48
PubTator Score 5.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.53798381918374E-9
malignant mesothelioma 3163 9.95583658504849E-6
group 4 medulloblastoma 1875 5.99738251287403E-5
atypical teratoid / rhabdoid tumor 4369 7.4995762048331E-5
medulloblastoma, large-cell 6234 1.88426075747352E-4
non primary Sjogren syndrome sicca 840 0.0269864017571244
Disease Target Count Z-score Confidence
Beckwith-Wiedemann syndrome 46 4.165 2.1
Cryptorchidism 67 3.914 2.0

Expression

Synonym

Accession Q9UL59 B2R8Q1
Symbols BAZ1
BAZ-1

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
21448237 For a number of genes affected by de novo copy number variants CNVs in autism (CNTNAP2, ZNF214, ARID1B, Proline Dehydrogenase), reduced transcript expression may be a mechanism of pathogenesis during neurodevelopment.

AA Sequence

MAVTFEDVTIIFTWEEWKFLDSSQKRLYREVMWENYTNVMSVENWNESYKSQEEKFRYLEYENFSYWQGW      1 - 70
WNAGAQMYENQNYGETVQGTDSKDLTQQDRSQCQEWLILSTQVPGYGNYELTFESKSLRNLKYKNFMPWQ     71 - 140
SLETKTTQDYGREIYMSGSHGFQGGRYRLGISRKNLSMEKEQKLIVQHSYIPVEEALPQYVGVICQEDLL    141 - 210
RDSMEEKYCGCNKCKGIYYWNSRCVFHKRNQPGENLCQCSICKACFSQRSDLYRHPRNHIGKKLYGCDEV    211 - 280
DGNFHQSSGVHFHQRVHIGEVPYSCNACGKSFSQISSLHNHQRVHTEEKFYKIECDKDLSRNSLLHIHQR    281 - 350
LHIGEKPFKCNQCGKSFNRSSVLHVHQRVHTGEKPYKCDECGKGFSQSSNLRIHQLVHTGEKSYKCEDCG    351 - 420
KGFTQRSNLQIHQRVHTGEKPYKCDDCGKDFSHSSDLRIHQRVHTGEKPYTCPECGKGFSKSSKLHTHQR    421 - 490
VHTGEKPYKCEECGKGFSQRSHLLIHQRVHTGEKPYKCHDCGKGFSHSSNLHIHQRVHTGEKPYQCAKCG    491 - 560
KGFSHSSALRIHQRVHAGEKPYKCREYYKGFDHNSHLHNNHRRGNL                            561 - 606
//

Text Mined References (8)

PMID Year Title
21448237 2011 Reduced transcript expression of genes affected by inherited and de novo CNVs in autism.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10762538 2000 Disruption of a novel imprinted zinc-finger gene, ZNF215, in Beckwith-Wiedemann syndrome.
7959730 1994 An integrated physical map of 210 markers assigned to the short arm of human chromosome 11.