Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.71
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -1.500 5.7e-03
cystic fibrosis 1.600 2.1e-03
esophageal adenocarcinoma -4.400 2.0e-02
interstitial cystitis -3.700 5.9e-03
lung adenocarcinoma 1.200 9.6e-04
lung cancer 1.100 8.2e-03
non-small cell lung cancer 1.893 1.2e-07
psoriasis -1.500 4.4e-04
spina bifida -2.398 4.5e-02
urothelial carcinoma -3.000 1.2e-03

Gene RIF (3)

AA Sequence

MMYRPDVVRARKRVCWEPWVIGLVIFISLIVLAVCIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGR      1 - 70
EASNNFTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFSQQKHGVLAHMLLICRFHSTEDPETVDKIVQL     71 - 140
VLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWPWQASLQ    141 - 210
WDGSHRCGATLINATWLVSAAHCFTTYKNPARWTASFGVTIKPSKMKRGLRRIIVHEKYKHPSHDYDISL    211 - 280
AELSSPVPYTNAVHRVCLPDASYEFQPGDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTCNEPQAYND    281 - 350
AITPRMLCAGSLEGKTDACQGDSGGPLVSSDARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWITSK    351 - 420
TGI                                                                       421 - 423
//

Text Mined References (13)

PMID Year Title