Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.30
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
urothelial carcinoma -3.000 0.001
esophageal adenocarcinoma -4.400 0.020
psoriasis -2.200 0.000
Atopic dermatitis -1.500 0.006
non-small cell lung cancer 1.893 0.000
lung cancer 1.700 0.014
interstitial cystitis -4.100 0.001
cystic fibrosis 1.600 0.002
lung adenocarcinoma 1.800 0.000
spina bifida -2.398 0.045

Gene RIF (3)

PMID Text
26856390 DESC1 may suppress esophageal squamous cell carcinoma development by sensitizing cells to apoptosis under an apoptotic stimulus through downregulating the EGFR/AKT signaling pathway.
25122802 study demonstrates that two cellular serine proteases, DESC1 and MSPL, activate influenza viruses and emerging coronaviruses in cell culture and, because of their expression in human lung tissue, might promote viral spread in the infected host
17388811 The domain of DESC1 exhibits a trypsin-like serine proteinase fold with a thrombin-like S1 pocket, a urokinase-type plasminogen activator-type S2 pocket, to accept small residues, and an open hydrophobic S3/S4 cavity to accept large hydrophobic residues.

AA Sequence

MMYRPDVVRARKRVCWEPWVIGLVIFISLIVLAVCIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGR      1 - 70
EASNNFTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFSQQKHGVLAHMLLICRFHSTEDPETVDKIVQL     71 - 140
VLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWPWQASLQ    141 - 210
WDGSHRCGATLINATWLVSAAHCFTTYKNPARWTASFGVTIKPSKMKRGLRRIIVHEKYKHPSHDYDISL    211 - 280
AELSSPVPYTNAVHRVCLPDASYEFQPGDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTCNEPQAYND    281 - 350
AITPRMLCAGSLEGKTDACQGDSGGPLVSSDARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWITSK    351 - 420
TGI                                                                       421 - 423
//

Publication (13)

PMID Year Title
26856390 2016 DESC1, a novel tumor suppressor, sensitizes cells to apoptosis by downregulating the EGFR/AKT pathway in esophageal squamous cell carcinoma.
25122802 2014 DESC1 and MSPL activate influenza A viruses and emerging coronaviruses for host cell entry.
23227193 2012 Analysis of copy number variation in Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
17388811 2007 Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328353 2004 Mouse DESC1 is located within a cluster of seven DESC1-like genes and encodes a type II transmembrane serine protease that forms serpin inhibitory complexes.
14696115 2004 Regulation of carcinoma cell invasion by protein C inhibitor whose expression is decreased in renal cell carcinoma.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...