Property Summary

Ligand Count 3
NCBI Gene PubMed Count 49
PubMed Score 13.27
PubTator Score 131.23

Knowledge Summary

Patent (14,841)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.300 4.2e-03
aldosterone-producing adenoma -1.054 3.4e-02
atypical teratoid / rhabdoid tumor -1.100 9.2e-05
ependymoma -1.700 6.0e-10
glioblastoma -1.100 1.2e-04
medulloblastoma, large-cell -1.100 3.8e-03
sonic hedgehog group medulloblastoma -1.300 8.7e-04

Gene RIF (29)

AA Sequence

MDARGGGGRPGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPPRAEALPPEAADEGG      1 - 70
PRGRLRSRDSSCGRPGTPGAASTAKGSPNGECGRGEPQCSPAGPEGPARGPKVSFSCRGAASGPAPGPGP     71 - 140
AEEAGSEEAGPAGEPRGSQASFMQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDF    141 - 210
RFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNTEIILDPE    211 - 280
KIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQW    281 - 350
EEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPRNCWVSINGMVNHSWSELYSFALFK    351 - 420
AMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFH    421 - 490
KLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKL    491 - 560
KFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRL    561 - 630
YSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLNSGVFNNQENAIIQEIVKYDRE    631 - 700
MVQQAELGQRVGLFPPPPPPPQVTSAIATLQQAAAMSFCPQVARPLVGPLALGSPRLVRRPPPGPAPAAA    701 - 770
SPGPPPPASPPGAPASPRAPRTSPYGGLPAAPLAGPALPARRLSRASRPLSASQPSLPHGAPGPAASTRP    771 - 840
ASSSTPRLGPTPAARAAAPSPDRRDSASPGAAGGLDPQDSARSRLSSNL                         841 - 889
//

Text Mined References (50)

PMID Year Title