Property Summary

NCBI Gene PubMed Count 41
Grant Count 101
R01 Count 60
Funding $11,852,701.29
PubMed Score 10.60
PubTator Score 131.23

Knowledge Summary

Patent (14,841)

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -1.700 0.000
glioblastoma -1.100 0.000
atypical teratoid/rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -1.100 0.004
adult high grade glioma -1.400 0.000
sonic hedgehog group medulloblastoma -1.300 0.001
aldosterone-producing adenoma -1.054 0.034

Synonym

Accession Q9UL51 O60742 O60743 O75267 Q9UBS2
Symbols BCNG2
HAC-1
BCNG-2

Gene

PDB

2MPF   3U10  

Gene RIF (25)

PMID Text
26005035 Aged patients with sinus rhythm exhibited significantly higher expression levels of HCN2 and HCN4 channel mRNA and protein (P<0.05), but significantly lower expression levels of miR1 and 133, compared with those of adult patients with sinus rhythm.
25423599 N-glycosylation is not required for HCN2 channels to function.
25197093 Data show that Rab8b-interacting protein TRIP8b does not compete with cyclic AMP for the same binding region of hyperpolarization activated cyclic nucleotide gated potassium channel 2 (HCN2).
24525276 Thermal hyperalgesia under chronic inflammatory conditions is mediated by HCN2 channels.
24324597 Novel HCN2 mutation contributes to febrile seizures by shifting the channel's kinetics in a temperature-dependent manner.
23907424 HCN2 polymorphism may play a role in chronic inflammatory periodontitis but not in peri-implantitis.
23395072 LBB-injected HCN2/SkM1 potentially provides a more clinically suitable biological pacemaker strategy than other reported constructs. This superiority is attributable to the more negative AP threshold and injection into the LBB
22131395 This is the first evidence in humans for a single-point, homozygous loss-of-function mutation in HCN2 potentially associated with generalized epilepsy with recessive inheritance.
22094222 HCN2 channels make an important contribution to the maintenance of spontaneous burst activity in embryonic cortical neuron cultures.
21615589 Genetic analysis in 48 Sudden unexpected death in epilepsy cases identified six novel and three previously reported nonsynonymous (amino acid changing) variants in HCN1 , HCN2, HCN3 and HCN4.
More...

AA Sequence

MDARGGGGRPGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPPRAEALPPEAADEGG      1 - 70
PRGRLRSRDSSCGRPGTPGAASTAKGSPNGECGRGEPQCSPAGPEGPARGPKVSFSCRGAASGPAPGPGP     71 - 140
AEEAGSEEAGPAGEPRGSQASFMQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDF    141 - 210
RFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNTEIILDPE    211 - 280
KIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQW    281 - 350
EEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPRNCWVSINGMVNHSWSELYSFALFK    351 - 420
AMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFH    421 - 490
KLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKL    491 - 560
KFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRL    561 - 630
YSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLNSGVFNNQENAIIQEIVKYDRE    631 - 700
MVQQAELGQRVGLFPPPPPPPQVTSAIATLQQAAAMSFCPQVARPLVGPLALGSPRLVRRPPPGPAPAAA    701 - 770
SPGPPPPASPPGAPASPRAPRTSPYGGLPAAPLAGPALPARRLSRASRPLSASQPSLPHGAPGPAASTRP    771 - 840
ASSSTPRLGPTPAARAAAPSPDRRDSASPGAAGGLDPQDSARSRLSSNL                         841 - 889
//

Text Mined References (42)

PMID Year Title
26005035 2015 Altered expression of hyperpolarization-activated cyclic nucleotide-gated channels and microRNA-1 and -133 in patients with age-associated atrial fibrillation.
25423599 2015 Effects of N-glycosylation on hyperpolarization-activated cyclic nucleotide-gated (HCN) channels.
25197093 2014 Structural basis for the mutual antagonism of cAMP and TRIP8b in regulating HCN channel function.
24525276 2014 HCN2 channels account for mechanical (but not heat) hyperalgesia during long-standing inflammation.
24324597 2013 Novel HCN2 mutation contributes to febrile seizures by shifting the channel's kinetics in a temperature-dependent manner.
23907424 2013 Hyperpolarization-activated cyclic nucleotide-gated 2 (HCN2) polymorphism is associated with chronic inflammatory periodontitis. A cross-sectional study.
23395072 2013 HCN2/SkM1 gene transfer into canine left bundle branch induces stable, autonomically responsive biological pacing at physiological heart rates.
22748890 2012 Investigation of hyperpolarization-activated cyclic nucleotide-gated channels in interstitial cells of Cajal of human bladder.
22131395 2011 Recessive loss-of-function mutation in the pacemaker HCN2 channel causing increased neuronal excitability in a patient with idiopathic generalized epilepsy.
22094222 2012 Hyperpolarization-activated cation current contributes to spontaneous network activity in developing neocortical cultures.
More...