Property Summary

NCBI Gene PubMed Count 51
PubMed Score 29.08
PubTator Score 17.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 1.5e-150

Synonym

Accession Q9UL46 Q15129
Symbols PA28B
REGbeta
PA28beta

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (34)

AA Sequence

MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPD      1 - 70
PPPKDDEMETDKQEKKEVHKCGFLPGNEKVLSLLALVKPEVWTLKEKCILVITWIQHLIPKIEDGNDFGV     71 - 140
AIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVHERDEAAYGELRAMVLDLR    141 - 210
AFYAELYHIISSNLEKIVNPKGEEKPSMY                                             211 - 239
//

Text Mined References (59)

PMID Year Title