Property Summary

NCBI Gene PubMed Count 49
Grant Count 8
R01 Count 7
Funding $413,769.9
PubMed Score 25.44
PubTator Score 17.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 0.000

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (35)

PMID Text
23898208 HIV-1 Tat upregulates the expression of proteasome activator subunit 2 (PSME2) in human primary T cells
23624078 Naa10p suppresses 28S proteasome activity through interaction with PA28beta.
22173998 knockdown of PA28beta could enhance tumor invasion and metastasis, at least in part, through up-regulation of CLIC1 in gastric adenocarcinoma
19403671 HIV-1 Tat upregulates the expression of proteasome activator subunit 2 (PSME2) in human primary T cells
18187620 HIV-1 Tat upregulates the expression of proteasome activator subunit 2 (PSME2) in human primary T cells
18187620 Knockdown of proteasome activator subunit 2 (PSME2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
14614829 HIV-1 Tat upregulates the expression of proteasome activator subunit 2 (PSME2) in human primary T cells
14564014 HIV-1 Tat upregulates the expression of proteasome activator subunit 2 (PSME2) in human primary T cells
14557625 HIV-1 Tat upregulates the expression of proteasome activator subunit 2 (PSME2) in human primary T cells
14550573 HIV-1 Tat upregulates the expression of proteasome activator subunit 2 (PSME2) in human primary T cells
More...

AA Sequence

MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPD      1 - 70
PPPKDDEMETDKQEKKEVHKCGFLPGNEKVLSLLALVKPEVWTLKEKCILVITWIQHLIPKIEDGNDFGV     71 - 140
AIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVHERDEAAYGELRAMVLDLR    141 - 210
AFYAELYHIISSNLEKIVNPKGEEKPSMY                                             211 - 239
//

Publication (57)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23624078 2013 N-?-acetyltransferase 10 protein is a negative regulator of 28S proteasome through interaction with PA28?.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22173998 2012 PA28? regulates cell invasion of gastric cancer via modulating the expression of chloride intracellular channel 1.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...