Property Summary

NCBI Gene PubMed Count 28
Grant Count 10
R01 Count 6
Funding $1,159,826.2
PubMed Score 64.81
PubTator Score 11.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 5.234 0.000
acute quadriplegic myopathy 1.101 0.000
aldosterone-producing adenoma -1.040 0.037
Pick disease -1.200 0.001
ovarian cancer 2.500 0.000

Protein-protein Interaction (3)

Gene RIF (3)

PMID Text
23750231 Mecp2 regulates the expression of components belonging to the dysbindin interactome
12576321 no defects in the known components of pallidin-muted complex (BLOC-1)have been identified in 142 patients with HPS, suggesting that BLOC-1 function may be critical in humans.
12191018 role in biogenesis of lysosome-related organelles

AA Sequence

MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQA      1 - 70
LQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQ     71 - 140
QKRQKEELEREQQREKEFEREKQLTARPAKRM                                          141 - 172
//

Publication (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24987500 2014 Highly expressed genes in human high grade gliomas: immunohistochemical analysis of data from the human protein atlas.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23750231 2013 MeCP2 regulates the synaptic expression of a Dysbindin-BLOC-1 network component in mouse brain and human induced pluripotent stem cell-derived neurons.
23563589 2013 An association study of the Hermansky-Pudlak syndrome type 4 gene in schizophrenic patients.
22203680 2012 Assembly and architecture of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
21998198 2011 The schizophrenia susceptibility factor dysbindin and its associated complex sort cargoes from cell bodies to the synapse.
21665000 2011 A BLOC-1 mutation screen reveals that PLDN is mutated in Hermansky-Pudlak Syndrome type 9.
19546860 2010 The dysbindin-containing complex (BLOC-1) in brain: developmental regulation, interaction with SNARE proteins and role in neurite outgrowth.
17182842 2007 BLOC-1 is required for cargo-specific sorting from vacuolar early endosomes toward lysosome-related organelles.
More...