Property Summary

NCBI Gene PubMed Count 29
PubMed Score 67.93
PubTator Score 11.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.101 7.4e-05
aldosterone-producing adenoma -1.040 3.7e-02
osteosarcoma 5.234 3.2e-10
ovarian cancer -1.900 3.5e-06
Pick disease -1.200 6.1e-04

Gene RIF (3)

AA Sequence

MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQA      1 - 70
LQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQ     71 - 140
QKRQKEELEREQQREKEFEREKQLTARPAKRM                                          141 - 172
//

Text Mined References (30)

PMID Year Title