Property Summary

NCBI Gene PubMed Count 28
PubMed Score 64.81
PubTator Score 11.03

Knowledge Summary


No data available


  Disease Sources (4)


  Differential Expression (5)

Disease log2 FC p
osteosarcoma 5.234 0.000
acute quadriplegic myopathy 1.101 0.000
aldosterone-producing adenoma -1.040 0.037
Pick disease -1.200 0.001
ovarian cancer 2.500 0.000


Accession Q9UL45 BLOC-1 subunit 6
Symbols PA


  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

23750231 Mecp2 regulates the expression of components belonging to the dysbindin interactome
12576321 no defects in the known components of pallidin-muted complex (BLOC-1)have been identified in 142 patients with HPS, suggesting that BLOC-1 function may be critical in humans.
12191018 role in biogenesis of lysosome-related organelles

AA Sequence

QKRQKEELEREQQREKEFEREKQLTARPAKRM                                          141 - 172

Text Mined References (29)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24987500 2014 Highly expressed genes in human high grade gliomas: immunohistochemical analysis of data from the human protein atlas.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23750231 2013 MeCP2 regulates the synaptic expression of a Dysbindin-BLOC-1 network component in mouse brain and human induced pluripotent stem cell-derived neurons.
23563589 2013 An association study of the Hermansky-Pudlak syndrome type 4 gene in schizophrenic patients.
22203680 2012 Assembly and architecture of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
21998198 2011 The schizophrenia susceptibility factor dysbindin and its associated complex sort cargoes from cell bodies to the synapse.
21665000 2011 A BLOC-1 mutation screen reveals that PLDN is mutated in Hermansky-Pudlak Syndrome type 9.
19546860 2010 The dysbindin-containing complex (BLOC-1) in brain: developmental regulation, interaction with SNARE proteins and role in neurite outgrowth.
17182842 2007 BLOC-1 is required for cargo-specific sorting from vacuolar early endosomes toward lysosome-related organelles.