Property Summary

NCBI Gene PubMed Count 20
PubMed Score 822.38
PubTator Score 1709.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.300 5.0e-03
aldosterone-producing adenoma -1.042 4.4e-02
astrocytic glioma -1.100 2.9e-02
atypical teratoid / rhabdoid tumor -2.400 3.8e-04
Breast cancer -1.300 3.5e-02
chronic lymphosyte leukemia 1.700 1.6e-02
cystic fibrosis -1.304 2.0e-05
ependymoma -1.100 1.8e-02
glioblastoma -1.800 1.0e-02
group 3 medulloblastoma -1.700 3.6e-02
lung cancer -1.200 3.6e-02
lung carcinoma 2.000 3.2e-27
medulloblastoma, large-cell -2.600 8.4e-04
non-small cell lung cancer -1.318 4.7e-05
osteosarcoma 1.671 4.4e-02
ovarian cancer -2.200 1.9e-05
Pick disease -1.400 1.2e-02

Gene RIF (3)

AA Sequence

MALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQEVLQETLKSLGRYRLLGKIFRKQENANAVLLELL      1 - 70
EDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPE     71 - 140
LLAHLLGQAMAHAPQPLLPMRYRKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPVTEAEKKRWLAESL    141 - 210
RGPALDLMHIVQADNPSISVEECLEAFKQVFGSLESRRTAQVRYLKTYQEEGEKVSAYVLRLETLLRRAV    211 - 280
EKRAIPRRIADQVRLEQVMAGATLNQMLWCRLRELKDQGPPPSFLELMKVIREEEEEEASFENESIEEPE    281 - 350
ERDGYGRWNHEGDD                                                            351 - 364
//

Text Mined References (22)

PMID Year Title