Property Summary

NCBI Gene PubMed Count 18
Grant Count 29
R01 Count 10
Funding $4,449,827.04
PubMed Score 789.82
PubTator Score 1709.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.100 0.029
ependymoma -1.100 0.018
glioblastoma -1.800 0.010
osteosarcoma 1.671 0.044
chronic lymphosyte leukemia 1.700 0.016
medulloblastoma -1.700 0.000
cystic fibrosis -1.304 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -2.600 0.001
non-small cell lung cancer -1.318 0.000
lung cancer -4.100 0.000
adult high grade glioma -1.300 0.005
aldosterone-producing adenoma -1.042 0.044
Breast cancer -1.300 0.035
lung carcinoma 2.000 0.000
Pick disease -1.400 0.012
ovarian cancer -2.200 0.000

Gene RIF (3)

PMID Text
27003254 PNMA2 functions as antagonist of MOAP-1 and PNMA1 through heterodimeric interaction
21729305 Immunohistochemical analysis of MA2/D2-40 combined with p16(INK4A) may have a significant implication in clinical practice for better identifying the grade of cervical intraepithelial neoplasia.
21209860 Ma2 may have a role in early recurrence of small intestine neuroendocrine tumors

AA Sequence

MALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQEVLQETLKSLGRYRLLGKIFRKQENANAVLLELL      1 - 70
EDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPE     71 - 140
LLAHLLGQAMAHAPQPLLPMRYRKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPVTEAEKKRWLAESL    141 - 210
RGPALDLMHIVQADNPSISVEECLEAFKQVFGSLESRRTAQVRYLKTYQEEGEKVSAYVLRLETLLRRAV    211 - 280
EKRAIPRRIADQVRLEQVMAGATLNQMLWCRLRELKDQGPPPSFLELMKVIREEEEEEASFENESIEEPE    281 - 350
ERDGYGRWNHEGDD                                                            351 - 364
//

Text Mined References (20)

PMID Year Title
27003254 2016 PNMA2 mediates heterodimeric interactions and antagonizes chemo-sensitizing activities mediated by members of PNMA family.
25416956 2014 A proteome-scale map of the human interactome network.
21729305 2011 Decreased D2-40 and increased p16INK4A immunoreactivities correlate with higher grade of cervical intraepithelial neoplasia.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21209860 2010 Paraneoplastic antigen Ma2 autoantibodies as specific blood biomarkers for detection of early recurrence of small intestine neuroendocrine tumors.
19366867 2009 Paraneoplastic antigen-like 5 gene (PNMA5) is preferentially expressed in the association areas in a primate specific manner.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...