Property Summary

NCBI Gene PubMed Count 23
PubMed Score 188.67
PubTator Score 22.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.300 4.6e-04
medulloblastoma, large-cell -1.300 4.8e-04
ovarian cancer -1.200 1.7e-05

Gene RIF (2)

AA Sequence

MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVEHMIQKNQCLF      1 - 70
TNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICN     71 - 140
MTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHR    141 - 210
KQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPM    211 - 280
QRQPIQKDSTTLED                                                            281 - 294
//

Text Mined References (29)

PMID Year Title