Property Summary

NCBI Gene PubMed Count 22
Grant Count 6
R01 Count 6
Funding $1,605,728
PubMed Score 163.35
PubTator Score 22.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.300 0.000
ovarian cancer -1.400 0.000

Gene RIF (2)

PMID Text
21715977 JAZ directly binds E2F1 in vitro in a dsRNA-independent manner, and JAZ's dsRNA binding ZF domains, which are necessary for localizing JAZ to the nucleus, are required for repression of transcriptional activity in vivo.
15254228 JAZ is exported by exportin-5 but translocates back into nuclei by a facilitated diffusion mechanism

AA Sequence

MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVEHMIQKNQCLF      1 - 70
TNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICN     71 - 140
MTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHR    141 - 210
KQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPM    211 - 280
QRQPIQKDSTTLED                                                            281 - 294
//

Text Mined References (27)

PMID Year Title
25875936 2015 Diagnostic potential of zinc finger protein-specific autoantibodies and associated linear B-cell epitopes in colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25331946 2014 JAZ (Znf346), a SIRT1-interacting protein, protects neurons by stimulating p21 (WAF/CIP1) protein expression.
24521053 2014 Structural characterization of interactions between the double-stranded RNA-binding zinc finger protein JAZ and nucleic acids.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21913182 2012 Multicenter study identified molecular blood-born protein signatures for Wilms Tumor.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21715977 2011 JAZ mediates G1 cell cycle arrest by interacting with and inhibiting E2F1.
More...