Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.74
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.421 0.000
astrocytic glioma -1.100 0.031
osteosarcoma 1.060 0.000
glioblastoma -1.200 0.000
non primary Sjogren syndrome sicca 1.200 0.017
ovarian cancer -1.200 0.000

Synonym

Accession Q9UL33 B2R4M9 Q6ZTA7 Q9NZZ4
Symbols HSPC176

Gene

AA Sequence

MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVY      1 - 70
GYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC     71 - 140
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24654229 2014 Slow overmethylation of housekeeping genes in the body mucosa is associated with the risk for gastric cancer.
21827752 2011 A yeast two hybrid screen identifies SPATA4 as a TRAPP interactor.
21525244 2011 C4orf41 and TTC-15 are mammalian TRAPP components with a role at an early stage in ER-to-Golgi trafficking.
21453443 2011 Organization and assembly of the TRAPPII complex.
21269460 2011 Initial characterization of the human central proteome.
21180879 2011 Transcriptional regulation of bidirectional gene pairs by 17-?-estradiol in MCF-7 breast cancer cells.
19416478 2009 TRAPPC2L is a novel, highly conserved TRAPP-interacting protein.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...