Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.74
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Parkinson Disease 105
Disease Target Count P-value
ovarian cancer 8492 3.84574434622284E-6
osteosarcoma 7933 1.92010060242129E-5
glioblastoma 5572 3.44371868013172E-5
chronic lymphocytic leukemia 244 1.02383431981884E-4
non primary Sjogren syndrome sicca 840 0.0171230118803571
astrocytic glioma 2241 0.0312144056771382
Disease Target Count Z-score Confidence
Atrophic gastritis 5 3.048 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
chronic lymphocytic leukemia 1.421 0.000
astrocytic glioma -1.100 0.031
osteosarcoma 1.060 0.000
glioblastoma -1.200 0.000
non primary Sjogren syndrome sicca 1.200 0.017
ovarian cancer -1.200 0.000

Synonym

Accession Q9UL33 B2R4M9 Q6ZTA7 Q9NZZ4
Symbols HSPC176

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG

AA Sequence

MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVY      1 - 70
GYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC     71 - 140
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24654229 2014 Slow overmethylation of housekeeping genes in the body mucosa is associated with the risk for gastric cancer.
21827752 2011 A yeast two hybrid screen identifies SPATA4 as a TRAPP interactor.
21525244 2011 C4orf41 and TTC-15 are mammalian TRAPP components with a role at an early stage in ER-to-Golgi trafficking.
21453443 2011 Organization and assembly of the TRAPPII complex.
21269460 2011 Initial characterization of the human central proteome.
21180879 2011 Transcriptional regulation of bidirectional gene pairs by 17-?-estradiol in MCF-7 breast cancer cells.
19416478 2009 TRAPPC2L is a novel, highly conserved TRAPP-interacting protein.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...