Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.74
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Atrophic gastritis 5 3.091 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.100 3.1e-02
Chronic Lymphocytic Leukemia 1.421 1.0e-04
glioblastoma -1.200 3.4e-05
non primary Sjogren syndrome sicca 1.200 1.7e-02
osteosarcoma 1.060 1.9e-05
ovarian cancer -1.200 3.8e-06

AA Sequence

MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVY      1 - 70
GYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC     71 - 140
//

Text Mined References (19)

PMID Year Title