Property Summary

NCBI Gene PubMed Count 29
Grant Count 8
R01 Count 4
Funding $443,665.31
PubMed Score 17.45
PubTator Score 20.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.451 0.024
psoriasis -1.400 0.000
osteosarcoma -1.049 0.001
glioblastoma 1.200 0.018
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -2.300 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.013
Breast cancer 3.300 0.026
aldosterone-producing adenoma -1.328 0.010
Pick disease -1.100 0.001
ovarian cancer -1.600 0.000

Gene RIF (13)

PMID Text
26382657 our results demonstrated that miR-203 act as a tumor suppressor miRNA through regulating RAB22A expression and suggested its involvement in osteosarcoma progression and carcinogenesis.
26344766 Data show that Rab22a- and Rab5a-driven phagosomal uptake is a crucial step in the vesicular cascade that leads to elimination of spirochetes by macrophages.
26041286 Vaccinia virus traffics to early endosomes, where recycling endosome markers Rab11 and Rab22 are recruited to participate in subsequent virus trafficking prior to virus core uncoating in the cytoplasm.
25550792 Re-expression of miR-193b in breast cancer cell lines decreased DNAJC13 (HPS40) and RAB22A expression, providing a mechanism by which mir193-b acts as a tumor suppressor.
25460499 these results demonstrate that miR-373 suppresses epithelial ovarian cancer invasion and metastasis by directly targeting Rab22a gene
25429829 miR-204-5p acts as a tumor suppressor in gastric cancer through inhibiting USP47 and RAB22A.
25294901 miR-204-5p acts as a tumor suppressor in colorectal cancer through inhibiting RAB22A and reveal RAB22A to be a new oncogene and prognostic factor for colorectal cancer.
24938788 Exposure of human breast cancer cells to hypoxia augments microvesicle (MVs) shedding that is mediated by the HIF-dependent expression of the small GTPase RAB22A, which colocalizes with budding MVs at the cell surface.
19759177 Data report the identification of Rab22 as a binding site on early endosomes for direct recruitment of Rabex-5 and activation of Rab5, establishing a Rab22-Rab5 signaling relay to promote early endosome fusion.
16537905 Rab22a controls the transport of the transferrin receptor from sorting to recycling endosomes.
More...

AA Sequence

MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRAL      1 - 70
APMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSI     71 - 140
HAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC                    141 - 194
//

Text Mined References (32)

PMID Year Title
26382657 2015 miR-203 Acts as a Tumor Suppressor Gene in Osteosarcoma by Regulating RAB22A.
26344766 2015 ER-Coordinated Activities of Rab22a and Rab5a Drive Phagosomal Compaction and Intracellular Processing of Borrelia burgdorferi by Macrophages.
26041286 2015 Intracellular Transport of Vaccinia Virus in HeLa Cells Requires WASH-VPEF/FAM21-Retromer Complexes and Recycling Molecules Rab11 and Rab22.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25550792 2014 Tumor suppressive microRNA-193b promotes breast cancer progression via targeting DNAJC13 and RAB22A.
25460499 2014 MiR-373 targeting of the Rab22a oncogene suppresses tumor invasion and metastasis in ovarian cancer.
25429829 2015 MicroRNA-204-5p inhibits gastric cancer cell proliferation by downregulating USP47 and RAB22A.
25416956 2014 A proteome-scale map of the human interactome network.
25294901 2014 miR-204-5p inhibits proliferation and invasion and enhances chemotherapeutic sensitivity of colorectal cancer cells by downregulating RAB22A.
24938788 2014 Hypoxia-inducible factors and RAB22A mediate formation of microvesicles that stimulate breast cancer invasion and metastasis.
More...