Property Summary

NCBI Gene PubMed Count 34
PubMed Score 19.68
PubTator Score 20.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.328 1.0e-02
atypical teratoid / rhabdoid tumor -1.600 1.2e-04
Breast cancer 3.300 2.6e-02
glioblastoma 1.200 1.8e-02
group 4 medulloblastoma -1.200 8.2e-04
intraductal papillary-mucinous carcinoma... 1.100 1.3e-02
medulloblastoma, large-cell -2.300 4.7e-05
Multiple myeloma 1.451 2.4e-02
osteosarcoma -1.049 9.8e-04
ovarian cancer -1.600 2.5e-06
Pick disease -1.100 7.9e-04
psoriasis -1.400 2.1e-04

Gene RIF (18)

AA Sequence

MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRAL      1 - 70
APMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSI     71 - 140
HAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC                    141 - 194
//

Text Mined References (37)

PMID Year Title