Property Summary

NCBI Gene PubMed Count 36
PubMed Score 23.11
PubTator Score 20.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Obesity 678 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.6e-05
tuberculosis 2010 2.4e-05
medulloblastoma, large-cell 6241 1.4e-04
Multiple myeloma 1332 2.4e-04
lung cancer 4740 1.2e-03
dermatomyositis 966 2.1e-03
hereditary spastic paraplegia 318 1.7e-02

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.200 2.1e-03
hereditary spastic paraplegia -1.136 1.7e-02
lung cancer -1.100 1.2e-03
medulloblastoma, large-cell -1.500 1.4e-04
Multiple myeloma 2.121 2.4e-04
ovarian cancer -1.500 1.6e-05
tuberculosis -1.100 2.4e-05

Gene RIF (6)

AA Sequence

MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNL      1 - 70
AIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKER     71 - 140
HVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDD    141 - 210
EPQAQTSGGGCCSSG                                                           211 - 225
//

Text Mined References (41)

PMID Year Title