Property Summary

NCBI Gene PubMed Count 36
PubMed Score 22.65
PubTator Score 20.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.121 0.000
medulloblastoma, large-cell -1.500 0.000
hereditary spastic paraplegia -1.136 0.017
tuberculosis -1.400 0.000
lung cancer -1.100 0.001
ovarian cancer 2.100 0.006
dermatomyositis 1.200 0.002

Synonym

Accession Q9UL25 Q14466 Q569H3
Symbols

Gene

PDB

1YZT   1YZU   1Z08   1Z0I   2OT3  

Gene RIF (6)

PMID Text
25648148 Starvation-induced MTMR13 and RAB21 activity regulates VAMP8 to promote autophagosome-lysosome fusion.
24477653 High RAB21 expression is associated with glioma.
22525675 Taken together, these data suggest that Rab21 plays a negative role in the EGF-mediated MAPK signaling pathway. Overexpression of Rab21 attenuated EGF-mediated mitogen-activated protein kinase (MAPK) signaling by inducing EGFR degradation.
19745841 show that TI-VAMP interacts with the Vps9 domain and ankyrin-repeat-containing protein Varp, a guanine nucleotide exchange factor of the small GTPase Rab21, through a specific domain herein called the interacting domain.
18804435 Results show that targeted trafficking of integrins to and from the cleavage furrow is required for successful cytokinesis, and that this is regulated by Rab21.
16754960 Rab21 (and Rab5) associate with the cytoplasmic domains of alpha-integrin chains, and their expression influences the endo/exocytic traffic of integrins. This function of Rab21 is dependent on its GTP/GDP cycle and proper membrane targeting

AA Sequence

MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNL      1 - 70
AIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKER     71 - 140
HVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDD    141 - 210
EPQAQTSGGGCCSSG                                                           211 - 225
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25648148 2015 Starvation-induced MTMR13 and RAB21 activity regulates VAMP8 to promote autophagosome-lysosome fusion.
24477653 2014 miR-200b as a prognostic factor targets multiple members of RAB family in glioma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22705394 2012 A molecular network for the transport of the TI-VAMP/VAMP7 vesicles from cell center to periphery.
22525675 2012 Rab21 attenuates EGF-mediated MAPK signaling through enhancing EGFR internalization and degradation.
22120710 2012 Cytokinesis failure due to derailed integrin traffic induces aneuploidy and oncogenic transformation in vitro and in vivo.
21768288 2011 Competitive binding of Rab21 and p120RasGAP to integrins regulates receptor traffic and migration.
More...