Property Summary

NCBI Gene PubMed Count 44
PubMed Score 69.38
PubTator Score 97.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 6.19141030162002E-26
juvenile dermatomyositis 1189 5.98939572124501E-10
posterior fossa group A ependymoma 1511 1.55690516675149E-7
malignant mesothelioma 3163 4.31004964279055E-7
chronic lymphosyte leukemia 232 1.44213151541604E-6
ovarian cancer 8492 6.31643508426002E-5
lung cancer 4473 9.66466760681066E-5
pilocytic astrocytoma 3086 1.1509833899827E-4
osteosarcoma 7933 5.44307724192636E-4
medulloblastoma, large-cell 6234 8.81508236156581E-4
pancreatic cancer 2300 0.00182580985092394
glioblastoma 5572 0.00213072874346101
subependymal giant cell astrocytoma 2287 0.00307534712021346
primary pancreatic ductal adenocarcinoma 1271 0.00328482658457135
active Crohn's disease 918 0.00343952951558142
primary Sjogren syndrome 789 0.00376003392629144
limb girdle muscular dystrophy 2I 56 0.00399866543985154
invasive ductal carcinoma 2950 0.00454515598645012
group 3 medulloblastoma 2254 0.0106419828460473
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0106847101134735
interstitial cystitis 2299 0.0125027601393287
cutaneous lupus erythematosus 1056 0.0136160744691937
esophageal adenocarcinoma 737 0.0195207517873976
adult high grade glioma 2148 0.0212520735480599
astrocytoma 1493 0.021727841065834
adrenocortical carcinoma 1427 0.0301275080226305
atypical teratoid / rhabdoid tumor 4369 0.0362473066950412
dermatomyositis 967 0.0375471492505591
active ulcerative colitis 477 0.0420657475077841
Disease Target Count Z-score Confidence
Poland syndrome 7 4.398 2.2

Expression

Synonym

Accession Q9UL19 B2R599 B4DDW2 E7ENZ7 O95200
Symbols RIG1
TIG3
HRSL4
HRASLS4
PLA1/2-3

Gene

PDB

2LKT   2MY9  

  Ortholog (2)

Species Source
Chimp OMA EggNOG
Dog OMA EggNOG Inparanoid

Gene RIF (29)

PMID Text
26535695 These observations highlight the importance of RIG-I signaling in anti-HIV innate immunity in macrophages, which may be beneficial for the treatment of HIV and aid in the understanding of the neuropathogenesis of HAND.
26464031 Letter: Interleukin-22 inhibits tazarotene-induced gene 3 expression in keratinocytes via MAPK-ERK1/2 and JAK2/STAT3 signaling.
26355912 Gal1 and gal3 regulate the inflammatory response in airway epithelial cells exposed to microbial neuraminidase by modulating the expression of SOCS1 and RIG1.
26299329 TRIM25 plays an additional role in RIG-I/MDA5 signaling other than RIG-I ubiquitination via activation of NF-kappaB.
26223644 During Crimean-Congo hemorrhagic fever virus infection, RIG-I mediated a type I interferon response via MAVS.
25871522 the flexible main loop of H-REV107, but not that of TIG3, is critical for its NTD to modulate its CTD in inducing cell death.
25752576 Viral pseudo-enzymes activate RIG-I via deamidation to evade cytokine production.
25361079 findings provide a new insight into the molecular link between p53, protein acylation and Wnt/beta-catenin signaling whereby RARRES3 plays a pivotal role in modulating the acylation status of signaling proteins.
25315416 MiR-545 exerts its effects in pancreatic ductal adenocarcinoma by directly targeting RIG-1
24867881 RARRES3 downregulation engages metastasis-initiating capabilities by facilitating adhesion of the tumor cells to the lung parenchyma.
More...

AA Sequence

MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVG      1 - 70
GCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVA     71 - 140
TALGILVVAGCSFAIRRYQKKATA                                                  141 - 164
//

Text Mined References (46)

PMID Year Title
26535695 2015 RIG-I detects HIV-1 infection and mediates type I interferon response in human macrophages from patients with HIV-1-associated neurocognitive disorders.
26464031 2015 Interleukin-22 inhibits tazarotene-induced gene 3 expression in HaCaT cells via MAPK-ERK1/2 and JAK2/STAT3 signaling.
26355912 2015 Galectins regulate the inflammatory response in airway epithelial cells exposed to microbial neuraminidase by modulating the expression of SOCS1 and RIG1.
26299329 2015 Regulation of MDA5-MAVS Antiviral Signaling Axis by TRIM25 through TRAF6-Mediated NF-?B Activation.
26223644 2015 RIG-I Mediates an Antiviral Response to Crimean-Congo Hemorrhagic Fever Virus.
25871522 2015 Structural and functional characterization of tumor suppressors TIG3 and H-REV107.
25752576 2015 Viral pseudo-enzymes activate RIG-I via deamidation to evade cytokine production.
25416956 2014 A proteome-scale map of the human interactome network.
25361079 2015 Involvement of RARRES3 in the regulation of Wnt proteins acylation and signaling activities in human breast cancer cells.
25315416 2014 miR-545 inhibited pancreatic ductal adenocarcinoma growth by targeting RIG-I.
More...