Property Summary

NCBI Gene PubMed Count 44
Grant Count 46
R01 Count 19
Funding $3,690,048.77
PubMed Score 69.38
PubTator Score 97.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (29)

PMID Text
26535695 These observations highlight the importance of RIG-I signaling in anti-HIV innate immunity in macrophages, which may be beneficial for the treatment of HIV and aid in the understanding of the neuropathogenesis of HAND.
26464031 Letter: Interleukin-22 inhibits tazarotene-induced gene 3 expression in keratinocytes via MAPK-ERK1/2 and JAK2/STAT3 signaling.
26355912 Gal1 and gal3 regulate the inflammatory response in airway epithelial cells exposed to microbial neuraminidase by modulating the expression of SOCS1 and RIG1.
26299329 TRIM25 plays an additional role in RIG-I/MDA5 signaling other than RIG-I ubiquitination via activation of NF-kappaB.
26223644 During Crimean-Congo hemorrhagic fever virus infection, RIG-I mediated a type I interferon response via MAVS.
25871522 the flexible main loop of H-REV107, but not that of TIG3, is critical for its NTD to modulate its CTD in inducing cell death.
25752576 Viral pseudo-enzymes activate RIG-I via deamidation to evade cytokine production.
25361079 findings provide a new insight into the molecular link between p53, protein acylation and Wnt/beta-catenin signaling whereby RARRES3 plays a pivotal role in modulating the acylation status of signaling proteins.
25315416 MiR-545 exerts its effects in pancreatic ductal adenocarcinoma by directly targeting RIG-1
24867881 RARRES3 downregulation engages metastasis-initiating capabilities by facilitating adhesion of the tumor cells to the lung parenchyma.
More...

AA Sequence

MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVG      1 - 70
GCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVA     71 - 140
TALGILVVAGCSFAIRRYQKKATA                                                  141 - 164
//

Text Mined References (46)

PMID Year Title
26535695 2015 RIG-I detects HIV-1 infection and mediates type I interferon response in human macrophages from patients with HIV-1-associated neurocognitive disorders.
26464031 2015 Interleukin-22 inhibits tazarotene-induced gene 3 expression in HaCaT cells via MAPK-ERK1/2 and JAK2/STAT3 signaling.
26355912 2015 Galectins regulate the inflammatory response in airway epithelial cells exposed to microbial neuraminidase by modulating the expression of SOCS1 and RIG1.
26299329 2015 Regulation of MDA5-MAVS Antiviral Signaling Axis by TRIM25 through TRAF6-Mediated NF-?B Activation.
26223644 2015 RIG-I Mediates an Antiviral Response to Crimean-Congo Hemorrhagic Fever Virus.
25871522 2015 Structural and functional characterization of tumor suppressors TIG3 and H-REV107.
25752576 2015 Viral pseudo-enzymes activate RIG-I via deamidation to evade cytokine production.
25416956 2014 A proteome-scale map of the human interactome network.
25361079 2015 Involvement of RARRES3 in the regulation of Wnt proteins acylation and signaling activities in human breast cancer cells.
25315416 2014 miR-545 inhibited pancreatic ductal adenocarcinoma growth by targeting RIG-I.
More...