Property Summary

NCBI Gene PubMed Count 52
PubMed Score 71.05
PubTator Score 97.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 2.820 3.4e-03
active ulcerative colitis 2.912 4.2e-02
adrenocortical carcinoma -1.056 3.0e-02
adult high grade glioma 1.700 2.1e-02
astrocytoma 1.200 3.0e-09
Astrocytoma, Pilocytic 1.800 1.2e-04
atypical teratoid / rhabdoid tumor -1.300 3.6e-02
chronic lymphosyte leukemia -1.200 1.4e-06
cutaneous lupus erythematosus 1.700 1.4e-02
dermatomyositis 2.100 3.8e-02
ependymoma 1.900 3.9e-06
esophageal adenocarcinoma 1.900 2.0e-02
glioblastoma 1.900 2.1e-03
group 3 medulloblastoma -2.000 1.1e-02
interstitial cystitis 1.700 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.600 1.1e-02
invasive ductal carcinoma 1.700 4.5e-03
juvenile dermatomyositis 2.473 6.0e-10
limb girdle muscular dystrophy 2I 1.384 4.0e-03
lung cancer -3.000 9.7e-05
lung carcinoma -2.600 6.2e-26
malignant mesothelioma -2.200 4.3e-07
medulloblastoma, large-cell -2.400 8.8e-04
osteosarcoma -2.414 5.4e-04
ovarian cancer -1.700 5.1e-03
pancreatic cancer 1.300 1.8e-03
primary pancreatic ductal adenocarcinoma 1.107 3.3e-03
primary Sjogren syndrome 1.300 3.8e-03
subependymal giant cell astrocytoma 2.630 3.1e-03

Gene RIF (37)

AA Sequence

MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVG      1 - 70
GCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVA     71 - 140
TALGILVVAGCSFAIRRYQKKATA                                                  141 - 164
//

Text Mined References (54)

PMID Year Title