Property Summary

NCBI Gene PubMed Count 71
Grant Count 34
R01 Count 20
Funding $4,252,720.2
PubMed Score 151.27
PubTator Score 96.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.100 0.001
lung cancer 1.300 0.001
group 3 medulloblastoma 1.100 0.003
Pick disease 1.300 0.000

Gene RIF (42)

PMID Text
26242502 Blocking AGO1, AGO2, or TRBP expression changes expression levels and nuclear distribution of RNAi factors Dicer, TNRC6A (GW182), and TRBP.
25656609 EIF2C2, Dicer, and Drosha are more highly expressed in bladder carcinoma, promote the development of bladder cancer, and suggested a poor prognosis
25313066 Argonaute-1 binds transcriptional enhancers and controls constitutive and alternative splicing
24086155 nuclear Ago1 directly interacts with RNA Polymerase II and is widely associated with chromosomal loci throughout the genome with preferential enrichment in promoters of transcriptionally active genes
23809764 Evolutionary amino acid changes to hAGO1 were readily reversible, suggesting that loading of guide RNA and pairing of seed-based miRNA and target RNA constrain its sequence drift.
23748378 The Ago1 N domain performed best when juxtaposed with cognate PAZ and MID. This exemplifies the importance of proper intermolecular-domain interactions.
23746446 Completion of the tetrad, combined with a mutation on a loop adjacent to the active site of hAgo1, results in slicer activity that is substantially enhanced by swapping in the N domain of hAgo2.
23696926 Aberrant expression of argonaute-1/-2 in human renal cell carcinoma is possibly involved with tumorigenesis and prognosis.
23665583 PIWI-domain mutations in Ago1 may misarrange the catalytic center. Replacing Ago1 cluster 2 by the sequence found in Ago2 fully activated the Ago1 PIWI domain only when the Ago1 PIWI domain was placed into the Ago2 backbone.
23426184 Tumor xenografts and human cancer specimens indicate that AGO1-mediated translational desuppression of VEGF may be associated with tumor angiogenesis and poor prognosis.
More...

AA Sequence

MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNR      1 - 70
EVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRM     71 - 140
LHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWK    141 - 210
MMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVC    211 - 280
NVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRC    281 - 350
IKKLTDNQTSTMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGG    351 - 420
RNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAGMPIQGQPCFC    421 - 490
KYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSN    491 - 560
LCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPPAGDGKKPSITAVVGSMDAHPSRYCATVRVQ    561 - 630
RPRQEIIEDLSYMVRELLIQFYKSTRFKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGI    631 - 700
TYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDN    701 - 770
RFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQAL    771 - 840
AKAVQVHQDTLRTMYFA                                                         841 - 857
//

Text Mined References (72)

PMID Year Title
26242502 2015 Reduced Expression of Argonaute 1, Argonaute 2, and TRBP Changes Levels and Intracellular Distribution of RNAi Factors.
25656609 2015 EIF2C, Dicer, and Drosha are up-regulated along tumor progression and associated with poor prognosis in bladder carcinoma.
25336585 2014 Cellular microRNAs up-regulate transcription via interaction with promoter TATA-box motifs.
25313066 2014 Argonaute-1 binds transcriptional enhancers and controls constitutive and alternative splicing in human cells.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24949972 2014 Programmed translational readthrough generates antiangiogenic VEGF-Ax.
24086155 2013 Ago1 Interacts with RNA polymerase II and binds to the promoters of actively transcribed genes in human cancer cells.
23809764 2013 Eukaryote-specific insertion elements control human ARGONAUTE slicer activity.
23748378 2013 Molecular dissection of human Argonaute proteins by DNA shuffling.
23746446 2013 The making of a slicer: activation of human Argonaute-1.
More...