Property Summary

NCBI Gene PubMed Count 158
Grant Count 447
R01 Count 219
Funding $57,275,086.79
PubMed Score 767.66
PubTator Score 319.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 0.002
osteosarcoma -1.502 0.001
lung adenocarcinoma -1.200 0.000
psoriasis 1.400 0.000

Synonym

Accession Q9UL17 T-box protein 21
Symbols TBET
T-PET
T-bet
TBLYM

Gene

PANTHER Protein Class (1)

Gene RIF (165)

PMID Text
27082299 A high copy number of T-bet and GATA-3 confers susceptibility to AAU and AS, and a high copy number of FOXP3 confers susceptibility to female patients with AAU either with or without AS.
26950239 There is a common program of effector T cell differentiation that is regulated by IL-2 and IL-12 signaling and the combined activities of the transcriptional regulators Blimp-1 and T-bet.
26809262 expression of T-bet may influence the function of HBV-specific CD8+ T cells and thus can be an attractive target for modulation to improve HBV-specific immunity in CHB.
26762769 TBX21 expression was low in multiple sclerosis (MS), and stable over time. The low EOMES/TBX21 phenotype in MS reflects cd56+ cell dysregulation.
26520896 HMGB1 contributed to IFN-gamma-producing Th17-cell bias in coronary artery atherosclerosis by controlling expression of T-bet and RUNX3.
26438526 the level of T-bet and Eomesodermin, two T-box transcription factors regulating lymphocyte effector functions, is strongly reduced in NK cells from allogeneic hematopoietic stem cell transplantation recipients compared with healthy control subjects.
26418311 Data indicate that overexpression of micrRNA miR-135a alters transcription factor T-bet and GATA binding protein 3 (GATA-3) mRNA expression in allergic rhinitis (AR).
26302932 T-bet expression might be associated with differentiation into effector memory cells and PD-1 expression in mycobacterial antigen-specific CD4(+) T cells.
26297793 Studies indicate that a key feature of age-associated B cells (ABCs) is that they express and depend upon B cell-intrinsic expression of the T-bet transcription factor.
26214042 Our data indicate that Tim-3 expression on NK cells is regulated by T-bet, and that Tim-3 levels correlate with advanced stages of gastric cancer
More...

AA Sequence

MGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSR      1 - 70
FLGAYAYPPRPQAAGFPGAGESFPPPADAEGYQPGEGYAAPDPRAGLYPGPREDYALPAGLEVSGKLRVA     71 - 140
LNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKA    141 - 210
EGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEP    211 - 280
EAACNASNTHIFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNCQFL    281 - 350
GGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYY    351 - 420
RGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDS    421 - 490
GLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN                             491 - 535
//

Publication (158)

PMID Year Title
27082299 2016 Association of T-Bet, GATA-3, RORC, and FOXP3 Copy Number Variations With Acute Anterior Uveitis With or Without Ankylosing Spondylitis in Chinese Han.
26950239 2016 A molecular threshold for effector CD8(+) T cell differentiation controlled by transcription factors Blimp-1 and T-bet.
26809262 2016 T-bet expression in CD8+ T cells associated with chronic hepatitis B virus infection.
26762769 2016 The low EOMES/TBX21 molecular phenotype in multiple sclerosis reflects CD56+ cell dysregulation and is affected by immunomodulatory therapies.
26520896 2015 IFN-?-producing Th17 cells bias by HMGB1-T-bet/RUNX3 axis might contribute to progression of coronary artery atherosclerosis.
26438526 2015 NK Cell Functional Impairment after Allogeneic Hematopoietic Stem Cell Transplantation Is Associated with Reduced Levels of T-bet and Eomesodermin.
26418311 2015 Intranasal Administration of Lentiviral miR-135a Regulates Mast Cell and Allergen-Induced Inflammation by Targeting GATA-3.
26302932 Elevated expression of T-bet in mycobacterial antigen-specific CD4(+) T cells from patients with tuberculosis.
26297793 2015 Age-Associated B Cells: A T-bet-Dependent Effector with Roles in Protective and Pathogenic Immunity.
26214042 2015 The Clinical Significance of Abnormal Tim-3 Expression on NK Cells from Patients with Gastric Cancer.
More...