Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 8.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 3.700 0.000
nasopharyngeal carcinoma -2.200 0.000
chronic rhinosinusitis -1.659 0.023
psoriasis 1.300 0.000

Gene RIF (4)

PMID Text
24976536 Down-regulated CCDC19 expression was observed in non-small cell lung cancers.
22997098 Used proteomics technology to globally examine NESG1-controlled proteins in nasopharyngeal carcinoma(NPC) cells. Interestingly, a-enolase (ENO1), an overexpressed gene in NPC, was confirmed as a NESG1-regulated protein in NPC cells.
22140479 Decreased NESG1 expression is an unfavorable prognostic factor for nasopharyngeal carcinoma.
20715168 Decreased expression of NESG1 is associated with nasopharyngeal carcinoma.

AA Sequence

MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTAL      1 - 70
GLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMD     71 - 140
AVMTRKKIMKQKEMVWNNNKKLSDLEEVAKERAQNLLQRANKLRMEQEEELKDMSKIILNAKCHAIRDAQ    141 - 210
ILEKQQIQKELDTEEKRLDQMMEVERQKSIQRQEELERKRREERIRGRRQIVEQMEKNQEERSLLAEQRE    211 - 280
QEKEQMLEYMEQLQEEDLKDMERRQQQKLKMQAEIKRINDENQKQKAELLAQEKLADQMVMEFTKKKMAR    281 - 350
EAEFEAEQERIRREKEKEIARLRAMQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENARKKMETEAEL    351 - 420
RKSRLEQVAFKEHALAVQVQRDRDEFERILRAQREQIEKERLEEEKKATGRLQHANELRRQVRENQQKEV    421 - 490
QNRIATFEEGRRLKEEAQKRRERIDEIKRKKLEELRATGLPEKYCIEAERKANILPATSVN             491 - 551
//

Text Mined References (10)

PMID Year Title
24976536 2014 Candidate tumour suppressor CCDC19 regulates miR-184 direct targeting of C-Myc thereby suppressing cell growth in non-small cell lung cancers.
22997098 2012 Proteomic features of potential tumor suppressor NESG1 in nasopharyngeal carcinoma.
22140479 2011 Potential tumor suppressor NESG1 as an unfavorable prognosis factor in nasopharyngeal carcinoma.
20715168 2011 Decreased expression of updated NESG1 in nasopharyngeal carcinoma: its potential role and preliminarily functional mechanism.
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10524255 1999 Molecular cloning of a novel tissue-specific gene from human nasopharyngeal epithelium.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.