Property Summary

NCBI Gene PubMed Count 29
PubMed Score 18.40
PubTator Score 8.96

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.001 8.6e-06
adult high grade glioma -1.400 3.5e-02
astrocytic glioma -2.000 4.2e-02
atypical teratoid / rhabdoid tumor -1.600 3.6e-03
diabetes mellitus 1.900 1.4e-03
glioblastoma -1.400 3.2e-03
medulloblastoma, large-cell -1.600 6.5e-04
osteosarcoma -1.640 1.4e-04
ovarian cancer 1.900 2.1e-04
Pick disease 1.400 1.4e-03
psoriasis -4.600 2.8e-06
Rheumatoid arthritis 2.100 9.6e-03
subependymal giant cell astrocytoma -1.331 3.6e-02
tuberculosis and treatment for 6 months 1.100 4.7e-05

Gene RIF (14)

AA Sequence

MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKR      1 - 70
AAQETERLLKELEQNANHPHRIEIQNIFEEAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTG     71 - 140
GKISLRKARYHTLTKICAVQEIIEDCMKKQPSLPLSEDAHPSVAKINFVMCEVNKARGVLIALLMGVNNN    141 - 210
ETCRHLSCVLSGLIADLDALDVCGRTEIRNYRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIE    211 - 280
KVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKE    281 - 350
ALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKC    351 - 420
KAARKQAVRLAQNILSYLDLKSDEWEY                                               421 - 447
//

Text Mined References (32)

PMID Year Title