Property Summary

NCBI Gene PubMed Count 27
PubMed Score 17.61
PubTator Score 8.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.77348674469341E-6
acute quadriplegic myopathy 1157 8.58429118049644E-6
tuberculosis and treatment for 6 months 686 4.66838306971903E-5
osteosarcoma 7933 1.38571377068301E-4
ovarian cancer 8492 2.13033303033993E-4
medulloblastoma, large-cell 6234 6.50390006000459E-4
diabetes mellitus 1663 0.00141658483473662
Pick disease 1893 0.00143806134722035
glioblastoma 5572 0.00323279024324171
atypical teratoid / rhabdoid tumor 4369 0.00358371220684275
Rheumatoid Arthritis 1171 0.00963211142706333
adult high grade glioma 2148 0.0348136549435081
subependymal giant cell astrocytoma 2287 0.0358161354742222
astrocytic glioma 2241 0.0418859247471075
Disease Target Count Z-score Confidence
Parkinson's disease 364 3.282 1.6

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 2.100 0.010
astrocytic glioma -2.000 0.042
psoriasis -4.600 0.000
osteosarcoma -1.640 0.000
atypical teratoid / rhabdoid tumor -1.600 0.004
glioblastoma -1.400 0.003
medulloblastoma, large-cell -1.600 0.001
acute quadriplegic myopathy 1.001 0.000
tuberculosis and treatment for 6 months 1.100 0.000
diabetes mellitus 1.900 0.001
adult high grade glioma -1.400 0.035
subependymal giant cell astrocytoma -1.331 0.036
Pick disease 1.400 0.001
ovarian cancer 1.900 0.000

Synonym

Accession Q9UL15 O94950 Q86W59 BAG-5
Symbols BAG-5

Gene

PANTHER Protein Class (1)

PDB

2D9D   3A8Y  

  Ortholog (12)

Gene RIF (12)

PMID Text
25006867 This study showed that BAG2 (Bcl-2 associated athanogene family protein 2) and BAG5 (Bcl-2-associated athanogene family protein 5) stabilise pathogenic ataxin3-80Q by inhibiting its ubiquitination.
24510904 BAG5 is a binding partners of LRRK2 and part of a complex that promotes clearance of Golgi-derived vesicles through the autophagy-lysosome system.
24475098 BAG5 protects against mitochondrial oxidative damage through regulating PINK1 degradation.
23448667 Bag5 is overexpressed in prostate cancer and plays a role in endoplamic reticulum-stress induced apoptosis. Furthermore we have identified GRP78/BiP as a novel interaction partner of Bag5.
21358815 A novel function for BAG5 as a modulator of CHIP E3 ubiquitin ligase activity with implications for CHIP-mediated regulation of alpha-syn oligomerization.
21131737 BAG5 directly interacts with Parkin and stabilizes Parkin via the ubiquitin-mediated proteasomal pathway.
20855536 We replicated the association of BCL2L11 and CASP9 with non-Hodgkin's lymphoma risk at the gene and SNP level, and identified novel associations with BCLAF1 and BAG5.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKR      1 - 70
AAQETERLLKELEQNANHPHRIEIQNIFEEAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTG     71 - 140
GKISLRKARYHTLTKICAVQEIIEDCMKKQPSLPLSEDAHPSVAKINFVMCEVNKARGVLIALLMGVNNN    141 - 210
ETCRHLSCVLSGLIADLDALDVCGRTEIRNYRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIE    211 - 280
KVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKE    281 - 350
ALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKC    351 - 420
KAARKQAVRLAQNILSYLDLKSDEWEY                                               421 - 447
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25006867 2015 The BAG2 and BAG5 proteins inhibit the ubiquitination of pathogenic ataxin3-80Q.
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24475098 2014 BAG5 protects against mitochondrial oxidative damage through regulating PINK1 degradation.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23448667 2013 Bcl-2 associated athanogene 5 (Bag5) is overexpressed in prostate cancer and inhibits ER-stress induced apoptosis.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...