Property Summary

NCBI Gene PubMed Count 14
PubMed Score 53.15
PubTator Score 718.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.633 0.003

Synonym

Accession Q9UL12 B2RMR5 B4DPI2 B7ZLT6 Q5SYV0 Q9Y280 Q9Y2Y3 SarDH
Symbols SAR
SDH
SARD
BPR-2
DMGDHL1

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Gene RIF (5)

PMID Text
25837163 Expression of sarcosine metabolism-related proteins differed between ILC [invasive lobular carcinoma] and IDC [invasive ductal carcinoma].
23824605 SARDH and TMEFF2 cooperate to modulate one-carbon metabolism and invasion of prostate cancer cells.
22825317 Mutations in the SARDH gene are associated with sarcosinemia.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASLSRALRVAAAHPRQSPTRGMGPCNLSSAAGPTAEKSVPYQRTLKEGQGTSVVAQGPSRPLPSTANVV      1 - 70
VIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSDVEVELLAHTRRVVSRELEEE     71 - 140
TGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESHVLSPAETKTLYPLMNVDDLYGTLYVPHDGT    141 - 210
MDPAGTCTTLARAASARGAQVIENCPVTGIRVWTDDFGVRRVAGVETQHGSIQTPCVVNCAGVWASAVGR    211 - 280
MAGVKVPLVAMHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLF    281 - 350
DLDWEVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGC    351 - 420
GQELAHWIIHGRPEKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHE    421 - 490
ELLGQGCVFQERHGWERPGWFHPRGPAPVLEYDYYGAYGSRAHEDYAYRRLLADEYTFAFPPHHDTIKKE    491 - 560
CLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSRPPGSTVYTCMLNHRGGTESDLTVSRLAPSH    561 - 630
QASPLAPAFEGDGYYLAMGGAVAQHNWSHITTVLQDQKSQCQLIDSSEDLGMISIQGPASRAILQEVLDA    631 - 700
DLSNEAFPFSTHKLLRAAGHLVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLINAGYRAIDS    701 - 770
LSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKSPVPFLGREALEQQRAAGLRRRLVCFTMEDKVPMFGLE    771 - 840
AIWRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVKSGDYALERMGVTYGAQAHLKSPFDPN    841 - 910
NKRVKGIY                                                                  911 - 918
//

Text Mined References (18)

PMID Year Title
25837163 2015 Expression of sarcosine metabolism-related proteins in invasive lobular carcinoma: comparison to invasive ductal carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23824605 2013 TMEFF2 and SARDH cooperate to modulate one-carbon metabolism and invasion of prostate cancer cells.
22825317 2012 Mutations in the sarcosine dehydrogenase gene in patients with sarcosinemia.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...