Property Summary

NCBI Gene PubMed Count 18
PubMed Score 118.91
PubTator Score 34.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 8.4e-07
tuberculosis 2010 5.6e-06
malignant mesothelioma 3232 1.6e-05
osteosarcoma 7950 5.6e-05
Pick disease 1894 4.9e-04
lung cancer 4740 4.7e-03
sarcoidosis 370 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (7)

Disease log2 FC p
lung cancer 2.000 4.7e-03
malignant mesothelioma 1.300 1.6e-05
osteosarcoma -1.408 5.6e-05
ovarian cancer 2.000 8.4e-07
Pick disease 1.200 4.9e-04
sarcoidosis 1.200 2.2e-02
tuberculosis -1.500 5.6e-06

Gene RIF (10)

AA Sequence

MPILLFLIDTSASMNQRSHLGTTYLDTAKGAVETFMKLRARDPASRGDRYMLVTFEEPPYAIKAGWKENH      1 - 70
ATFMNELKNLQAEGLTTLGQSLRTAFDLLNLNRLVTGIDNYGQGRNPFFLEPAIIITITDGSKLTTTSGV     71 - 140
QDELHLPLNSPLPGSELTKEPFRWDQRLFALVLRLPGTMSVESEQLTGVPLDDSAITPMCEVTGGRSYSV    141 - 210
CSPRMLNQCLESLVQKVQSGVVINFEKAGPDPSPVEDGQPDISRPFGSQPWHSCHKLIYVRPNPKTGVPI    211 - 280
GHWPVPESFWPDQNSPTLPPRTSHPVVKFSCTDCEPMVIDKLPFDKYELEPSPLTQFILERKSPQTCWQV    281 - 350
YVSNSAKYSELGHPFGYLKASTALNCVNLFVMPYNYPVLLPLLDDLFKVHKAKPTLKWRQSFESYLKTMP    351 - 420
PYYLGPLKKAVRMMGAPNLIADSMEYGLSYSVISYLKKLSQQAKIESDRVIGSVGKKVVQETGIKVRSRS    421 - 490
HGLSMAYRKDFQQLLQGISEDVPHRLLDLNMKEYTGFQVALLNKDLKPQTFRNAYDIPRRNLLDHLTRMR    491 - 560
SNLLKSTRRFLKGQDEDQVHSVPIAQMGNYQEYLKQVPSPLRELDPDQPRRLHTFGNPFKLDKKGMMIDE    561 - 630
ADEFVAGPQNKHKRPGEPNMQGIPKRRRCMSPLLRGRQQNPVVNNHIGGKGPPAPTTQAQPDLIKPLPLH    631 - 700
KISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGF    701 - 770
LENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGS    771 - 840
LQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN                           841 - 887
//

Text Mined References (20)

PMID Year Title