Property Summary

NCBI Gene PubMed Count 17
Grant Count 20
R01 Count 12
Funding $2,733,137.17
PubMed Score 110.07
PubTator Score 34.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -1.408 0.000
tuberculosis and treatment for 3 months -1.700 0.000
lung cancer 2.000 0.005
sarcoidosis 1.200 0.022
Pick disease 1.200 0.000
ovarian cancer 2.000 0.000

Gene RIF (10)

PMID Text
25686840 Findings demonstrate INTS6P1 and INTS6 exert the tumor suppressive roles through competing for oncomiR-17-5p.
25660097 DICE1 appears to be involved in prostate cancer progression rather than in the initiation of prostate cancer.
23986477 In response to the DNA damage response, INTS3-hSSB1-INTS6 complex relocates to the DNA damage sites.
23280823 Findings suggest that EBV encoded miR-BART3* miRNA targets DICE1 tumor suppressor to promote cellular growth and transformation in nasopharyngeal cancer(NPC).
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
18854154 Knockdown of integrator complex subunit 6 (INTS6) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16271964 Not mutated in human cancer cell lines which demonstratse 13q14 deletions.
15254679 DICE1 has a growth-suppressing activity and interferes with anchorage-independent growth of IGF-IR transformed tumor cells dependent upon IGF-I signaling
12527901 Somatic mutations were identified in three patients (3/56, 5%), and one novel polymorphism was identified in 3% of ESCC patients (4/136) and 3% of healthy individuals (6/232). We conclude that DICE1 mutations occur in ESCC but are infrequent.
11939413 Molecular characterization of the tumor suppressor gene in lung carcinoma cells

AA Sequence

MPILLFLIDTSASMNQRSHLGTTYLDTAKGAVETFMKLRARDPASRGDRYMLVTFEEPPYAIKAGWKENH      1 - 70
ATFMNELKNLQAEGLTTLGQSLRTAFDLLNLNRLVTGIDNYGQGRNPFFLEPAIIITITDGSKLTTTSGV     71 - 140
QDELHLPLNSPLPGSELTKEPFRWDQRLFALVLRLPGTMSVESEQLTGVPLDDSAITPMCEVTGGRSYSV    141 - 210
CSPRMLNQCLESLVQKVQSGVVINFEKAGPDPSPVEDGQPDISRPFGSQPWHSCHKLIYVRPNPKTGVPI    211 - 280
GHWPVPESFWPDQNSPTLPPRTSHPVVKFSCTDCEPMVIDKLPFDKYELEPSPLTQFILERKSPQTCWQV    281 - 350
YVSNSAKYSELGHPFGYLKASTALNCVNLFVMPYNYPVLLPLLDDLFKVHKAKPTLKWRQSFESYLKTMP    351 - 420
PYYLGPLKKAVRMMGAPNLIADSMEYGLSYSVISYLKKLSQQAKIESDRVIGSVGKKVVQETGIKVRSRS    421 - 490
HGLSMAYRKDFQQLLQGISEDVPHRLLDLNMKEYTGFQVALLNKDLKPQTFRNAYDIPRRNLLDHLTRMR    491 - 560
SNLLKSTRRFLKGQDEDQVHSVPIAQMGNYQEYLKQVPSPLRELDPDQPRRLHTFGNPFKLDKKGMMIDE    561 - 630
ADEFVAGPQNKHKRPGEPNMQGIPKRRRCMSPLLRGRQQNPVVNNHIGGKGPPAPTTQAQPDLIKPLPLH    631 - 700
KISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGF    701 - 770
LENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGS    771 - 840
LQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN                           841 - 887
//

Publication (19)

PMID Year Title
25686840 2015 Pseudogene INTS6P1 regulates its cognate gene INTS6 through competitive binding of miR-17-5p in hepatocellular carcinoma.
25660097 2015 Genetic Variants of DICE1/INTS6 in German Prostate Cancer Families with Linkage to 13q14.
23986477 2013 A core hSSB1-INTS complex participates in the DNA damage response.
23280823 2013 Targeting of DICE1 tumor suppressor by Epstein-Barr virus-encoded miR-BART3* microRNA in nasopharyngeal carcinoma.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16271964 2005 Absence of mutations in DICE1/DDX26 gene in human cancer cell lines with frequent 13q14 deletions.
16239144 2005 Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II.
More...