Property Summary

NCBI Gene PubMed Count 14
Grant Count 7
R01 Count 7
Funding $746,842.13
PubMed Score 6.67
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
psoriasis -1.700 0.006
glioblastoma 2.300 0.000
cystic fibrosis 3.874 0.000
autosomal dominant Emery-Dreifuss muscul... 1.190 0.011
fascioscapulohumeral muscular dystrophy 1.645 0.000
Atopic dermatitis -2.900 0.000
non-small cell lung cancer -2.492 0.000
lung cancer -4.200 0.000
colon cancer -2.900 0.000
breast carcinoma -2.700 0.002
fibroadenoma -3.900 0.008
lung adenocarcinoma -2.300 0.000
adult high grade glioma 1.900 0.001
group 3 medulloblastoma 2.700 0.000
pilocytic astrocytoma 2.500 0.000
nasopharyngeal carcinoma 2.000 0.011
lung carcinoma -1.500 0.000
ductal carcinoma in situ -4.400 0.001
invasive ductal carcinoma -5.600 0.000
ovarian cancer -5.000 0.000

Gene RIF (4)

PMID Text
26218419 Procollagen C-endopeptidase protein 2, atherosclerosis and HDL cholesteryl ester catabolism. [Review]
19237735 Data indicate that PCPE2 accelerates the proteolytic processing of pro-apolipoprotein (apo) AI by enhancing the cleavage of the hexapeptide extension present at the N terminus of apoAI.
12393877 PCPE2 is shown to be a glycoprotein that differs markedly in the nature of its glycosylation from that of PCPE1
12063410 Assignment of Pcolce2 gene, which encodes procollagen C-proteinase enhancer protein 2, to human chromosome 3q23.

AA Sequence

MRGANAWAPLCLLLAAATQLSRQQSPERPVFTCGGILTGESGFIGSEGFPGVYPPNSKCTWKITVPEGKV      1 - 70
VVLNFRFIDLESDNLCRYDFVDVYNGHANGQRIGRFCGTFRPGALVSSGNKMMVQMISDANTAGNGFMAM     71 - 140
FSAAEPNERGDQYCGGLLDRPSGSFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELKFEKFDVERDNYCRY    141 - 210
DYVAVFNGGEVNDARRIGKYCGDSPPAPIVSERNELLIQFLSDLSLTADGFIGHYIFRPKKLPTTTEQPV    211 - 280
TTTFPVTTGLKPTVALCQQKCRRTGTLEGNYCSSDFVLAGTVITTITRDGSLHATVSIINIYKEGNLAIQ    281 - 350
QAGKNMSARLTVVCKQCPLLRRGLNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLDALKNKQC         351 - 415
//

Publication (15)

PMID Year Title
26218419 2015 What does procollagen C-endopeptidase enhancer protein 2 have to do with HDL-cholesteryl ester uptake? Or how I learned to stop worrying and love reverse cholesterol transport?
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19237735 2009 Regulation of apoAI processing by procollagen C-proteinase enhancer-2 and bone morphogenetic protein-1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...