Property Summary

NCBI Gene PubMed Count 22
PubMed Score 59.49
PubTator Score 3405.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.13968872276967E-6
tuberculosis and treatment for 6 months 686 9.14815423995E-5
atypical teratoid / rhabdoid tumor 4369 2.5012836697753E-4
lung cancer 4473 2.63146315718697E-4
Pick disease 1893 3.81819420770182E-4
cutaneous lupus erythematosus 1056 0.00194264497471584
Atopic dermatitis 944 0.00238391761800561
pilocytic astrocytoma 3086 0.00701589459777559
pediatric high grade glioma 2712 0.00782600190921215
glioblastoma 5572 0.00903449157450295
group 4 medulloblastoma 1875 0.0101830742618459
invasive ductal carcinoma 2950 0.022718577757369
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Intermediate coronary syndrome 12 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.035 1.5

Expression

  Differential Expression (12)

Synonym

Accession Q9UKZ4 B2RTR5 Q5JZ17 Ten-1
Symbols TNM
ODZ1
ODZ3
TNM1
TEN-M1

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid

 CSPA Cell Line (2)

Gene RIF (8)

PMID Text
26485751 Data suggest teneurin-1/TENM1 (and possibly TENM3) undergoes proteolysis to TCAPs (teneurin C-terminal associated peptides) that form intercellular adhesive units with latrophilin; signaling via TENM1 TCAPs appears to regulate reproduction. [REVIEW]
25666757 This study identified predicted pathogenic, hemizygous variants on chromosome X in disease genes TENM1.
25648896 The teneurin-1 intracellular domain binds HINT1, thus switching on MITF-dependent transcription of GPNMB.
25152333 Studies indicate that teneurin-1 has been suggested as a candidate target gene for X-lined mental retardation.
23898208 HIV-1 Tat downregulates the expression of teneurin transmembrane protein 1 (TENM1; ODZ1) in human primary T cells
22271700 Subsequent analysis showed that the deletion in both cousins was identical and involved the whole SH2D1A gene and a part of the adjacent ODZ1 gene.
21651764 Data show that human teneurin-1 is directly regulated by EMX2 at a conserved promoter region upstream of the transcription start site, and identify and characterize the EMX2 dependent promoter element of human teneurin-1.
15777793 teneurin-1 plays a role in intracellular signaling

AA Sequence

MEQTDCKPYQPLPKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQSRKRKEVEKS      1 - 70
TQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVDTETEGAASPDHALRMWIRGMKSEHSSCLSSRA     71 - 140
NSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDVQSSPHNQFTFRPLPPPPPPPHACTCARKPP    141 - 210
PAADSLQRRSMTTRSQPSPAAPAPPTSTQDSVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNY    211 - 280
PLTSNTVYSPPPRPLPRSTFSRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQ    281 - 350
PVEGELYANGVSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRF    351 - 420
QITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQHSPRNLILTS    421 - 490
LQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNGECISGHCHCFPGFLGPDCAR    491 - 560
DSCPVLCGGNGEYEKGHCVCRHGWKGPECDVPEEQCIDPTCFGHGTCIMGVCICVPGYKGEICEEEDCLD    561 - 630
PMCSNHGICVKGECHCSTGWGGVNCETPLPVCQEQCSGHGTFLLDAGVCSCDPKWTGSDCSTELCTMECG    631 - 700
SHGVCSRGICQCEEGWVGPTCEERSCHSHCTEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCF    701 - 770
GNGRCTLDQNGWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYISPLCQGSPDP    771 - 840
LDLIQQSQTLFSQHTSRLFYDRIKFLIGKDSTHVIPPEVSFDSRRACVIRGQVVAIDGTPLVGVNVSFLH    841 - 910
HSDYGFTISRQDGSFDLVAIGGISVILIFDRSPFLPEKRTLWLPWNQFIVVEKVTMQRVVSDPPSCDISN    911 - 980
FISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIPSSFVRLSYLSSRTPGYKTLLRILLTHSTIP    981 - 1050
VGMIKVHLTVAVEGRLTQKWFPAAINLVYTFAWNKTDIYGQKVWGLAEALVSVGYEYETCPDFILWEQRT   1051 - 1120
VVLQGFEMDASNLGGWSLNKHHILNPQSGIIHKGNGENMFISQQPPVISTIMGNGHQRSVACTNCNGPAH   1121 - 1190
NNKLFAPVALASGPDGSVYVGDFNFVRRIFPSGNSVSILELSTSPAHKYYLAMDPVSESLYLSDTNTRKV   1191 - 1260
YKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITVDRHGFIYFVDGTMIRKI   1261 - 1330
DENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLYVLDNNIVLQISENRRVRIIA   1331 - 1400
GRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGLLFIAETDERKVNRIQQVTTNGEIYIIAGAPTD   1401 - 1470
CDCKIDPNCDCFSGDGGYAKDAKMKAPSSLAVSPDGTLYVADLGNVRIRTISRNQAHLNDMNIYEIASPA   1471 - 1540
DQELYQFTVNGTHLHTLNLITRDYVYNFTYNSEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWL   1541 - 1610
TISSNGVLKRVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEK   1611 - 1680
LTKVELDTSNRENVLMSTNLTATSTIYILKQENTQSTYRVNPDGSLRVTFASGMEIGLSSEPHILAGAVN   1681 - 1750
PTLGKCNISLPGEHNANLIEWRQRKEQNKGNVSAFERRLRAHNRNLLSIDFDHITRTGKIYDDHRKFTLR   1751 - 1820
ILYDQTGRPILWSPVSRYNEVNITYSPSGLVTFIQRGTWNEKMEYDQSGKIISRTWADGKIWSYTYLEKS   1821 - 1890
VMLLLHSQRRYIFEYDQPDCLLSVTMPSMVRHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTL   1891 - 1960
HLGTGRRVLYKYTKQARLSEVLYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFS   1961 - 2030
EEGLVNARFDYSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTK   2031 - 2100
IFSANGQVIEVQYEILKAIAYWMTIQYDNVGRMVICDIRVGVDANITRYFYEYDADGQLQTVSVNDKTQW   2101 - 2170
RYSYDLNGNINLLSHGKSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQRGNDIFEYNSNGLLQKAYNK   2171 - 2240
ASGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLTNPIRVTHLYNHTSSEITSLYYDLQGHLIAMELSSG   2241 - 2310
EEYYVACDNTGTPLAVFSSRGQVIKEILYTPYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDV   2311 - 2380
VAGRWTTPNHHIWKQLNLLPKPFNLYSFENNYPVGKIQDVAKYTTDIRSWLELFGFQLHNVLPGFPKPEL   2381 - 2450
ENLELTYELLRLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYNDGRCLEGGKQPRFAAVPS   2451 - 2520
VFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFIKLGSLEEDLVLIGN   2521 - 2590
TGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWT   2591 - 2660
KEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR        2661 - 2725
//

Text Mined References (26)

PMID Year Title
26485751 2015 Role of the teneurins, teneurin C-terminal associated peptides (TCAP) in reproduction: clinical perspectives.
25666757 2015 Whole-exome sequencing points to considerable genetic heterogeneity of cerebral palsy.
25648896 2015 The intracellular domain of teneurin-1 induces the activity of microphthalmia-associated transcription factor (MITF) by binding to transcriptional repressor HINT1.
25152333 2014 The teneurins: new players in the generation of visual topography.
24058526 2013 Genome-wide meta-analysis of systolic blood pressure in children with sickle cell disease.
23092983 2012 Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
22271700 2012 Skin lesions in a boy with X-linked lymphoproliferative disorder: comparison of 5 SH2D1A deletion cases.
21651764 2011 Human teneurin-1 is a direct target of the homeobox transcription factor EMX2 at a novel alternate promoter.
More...