Property Summary

NCBI Gene PubMed Count 9
PubMed Score 14.69
PubTator Score 114.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UKZ1 Q6P2M9 Q8N681
Symbols C40
C2orf29

Gene

Gene RIF (2)

PMID Text
23303381 Human CNOT10 and CNOT11 form a complex that interacts with the CNOT1 N-terminal domain.
23232451 CNOT11 interacts with the first amino acids of CNOT1 and with CNOT10 and is required for the association of CNOT10 with the CCR4-NOT complex.

AA Sequence

MPGGGASAASGRLLTAAEQRGSREAAGSASRSGFGGSGGGRGGASGPGSGSGGPGGPAGRMSLTPKELSS      1 - 70
LLSIISEEAGGGSTFEGLSTAFHHYFSKADHFRLGSVLVMLLQQPDLLPSAAQRLTALYLLWEMYRTEPL     71 - 140
AANPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAPPRELFKKTPRQIALMDVG    141 - 210
NMGQSVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQITEALVSGPKPPIESHF    211 - 280
RPEFIRPPPPLHICEDELAWLNPTEPDHAIQWDKSMCVKNSTGVEIKRIMAKAFKSPLSSPQQTQLLGEL    281 - 350
EKDPKLVYHIGLTPAKLPDLVENNPLVAIEMLLKLMQSSQITEYFSVLVNMDMSLHSMEVVNRLTTAVDL    351 - 420
PPEFIHLYISNCISTCEQIKDKYMQNRLVRLVCVFLQSLIRNKIINVQDLFIEVQAFCIEFSRIREAAGL    421 - 490
FRLLKTLDTGETPSETKMSK                                                      491 - 510
//

Publication (11)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23303381 2013 NOT10 and C2orf29/NOT11 form a conserved module of the CCR4-NOT complex that docks onto the NOT1 N-terminal domain.
23232451 2013 C2ORF29/CNOT11 and CNOT10 form a new module of the CCR4-NOT complex.
21269460 2011 Initial characterization of the human central proteome.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...