Property Summary

NCBI Gene PubMed Count 14
PubMed Score 30.15
PubTator Score 27.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.082 1.6e-04
atypical teratoid / rhabdoid tumor 2.200 2.2e-04
dermatomyositis -1.300 3.0e-04
ependymoma 1.200 1.1e-04
gastric cancer -1.500 1.9e-02
Gaucher disease type 1 -1.500 4.6e-02
glioblastoma 1.100 1.1e-02
group 4 medulloblastoma 1.600 6.5e-03
lung adenocarcinoma -1.200 1.0e-08
medulloblastoma, large-cell 2.800 3.0e-05
non primary Sjogren syndrome sicca 1.400 2.6e-02
oligodendroglioma 1.100 1.5e-02
osteosarcoma -1.129 4.3e-04
ovarian cancer -1.700 6.7e-06
pancreatic cancer -1.300 3.7e-02
pancreatic carcinoma -1.300 3.7e-02
pediatric high grade glioma 1.500 6.7e-03
Polycystic ovary syndrome -1.027 2.8e-02
psoriasis 1.200 1.2e-03
tuberculosis and treatment for 6 months 1.200 3.2e-04

Synonym

Accession Q9UKY7 B3KUC2 Q96IP9
Symbols H41

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAG      1 - 70
PGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKSSGP     71 - 140
WNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRKD    141 - 210
KEMEKSFEVVRHKNRGRDEVSKNQALKLQLDNQYAVLENQKSSHSQYN                          211 - 258
//

Text Mined References (23)

PMID Year Title