Property Summary

NCBI Gene PubMed Count 14
PubMed Score 26.84
PubTator Score 27.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
gastric cancer -1.500 0.019
pancreatic cancer -1.300 0.037
oligodendroglioma 1.100 0.015
psoriasis 1.200 0.001
osteosarcoma -1.129 0.000
ependymoma 1.200 0.000
medulloblastoma 1.800 0.007
glioblastoma 2.100 0.002
atypical teratoid / rhabdoid tumor 2.200 0.000
medulloblastoma, large-cell 2.800 0.000
acute quadriplegic myopathy 1.082 0.000
tuberculosis and treatment for 6 months 1.200 0.000
pediatric high grade glioma 1.500 0.007
non primary Sjogren syndrome sicca 1.400 0.026
pancreatic carcinoma -1.300 0.037
lung adenocarcinoma -1.200 0.000
Polycystic Ovary Syndrome -1.027 0.028
ovarian cancer -1.700 0.000
Gaucher disease type 1 -1.500 0.046
dermatomyositis -1.300 0.000

Synonym

Accession Q9UKY7 B3KUC2 Q96IP9
Symbols H41

Gene

Gene RIF (2)

PMID Text
25631074 Cellular biotinylated CDV3 mouse homolog protein is incorporated into HIV-1 Gag virus-like particles
12359334 Differential mRNA display shows increased levels of CDV3 in mice with cardiac hypertrophy.

AA Sequence

MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAG      1 - 70
PGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKSSGP     71 - 140
WNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRKD    141 - 210
KEMEKSFEVVRHKNRGRDEVSKNQALKLQLDNQYAVLENQKSSHSQYN                          211 - 258
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23568457 2013 Genetic variants associated with disordered eating.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21811255 2011 A two-phase case-control study for colorectal cancer genetic susceptibility: candidate genes from chromosomal regions 9q22 and 3q22.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...