Property Summary

NCBI Gene PubMed Count 8
Grant Count 178
R01 Count 91
Funding $43,126,271
PubMed Score 677.23
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Synonym

Accession Q9UKY3 A2RRL8 B9ZVS2
Symbols CES4
CESR
PCE-3
CES1A2
CES1A3

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
24535487 Results show that CES1A2 A(-816C and the CYP2C19 loss-of-function alleles were associated with attenuated platelet reactivity to clopidogrel.
21510813 There is a marked difference in mutant C allele between Chinese Han and Yao populations, suggesting individual and ethnic differences of CES1 drug metabolism between these two populations.
20195289 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWLPALVLATLAASAAWAGHLSSPPLVDTLHGKVLGKFVSLEGFAQPVAVFLGIPFAKPPLGPLRFTLPQ      1 - 70
PAEPWNFVKNATSYPPMFTQDPKAGQLISELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWI     71 - 140
HGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSPGNWGHLDQLAALHWVQDNIASFG    141 - 210
GNPGSVTIFGGSVGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEVGLRLVRLRLDTP    211 - 280
TSLALCS                                                                   281 - 287
//

Publication (10)

PMID Year Title
24535487 2014 The effects of CES1A2 A(-816)C and CYP2C19 loss-of-function polymorphisms on clopidogrel response variability among Chinese patients with coronary heart disease.
21510813 2011 Mutation-sensitive molecular switch method to detect CES1A2 mutation in the Chinese Han and Yao populations.
20931200 2010 Recommended nomenclature for five mammalian carboxylesterase gene families: human, mouse, and rat genes and proteins.
20195289 2010 Genetic variation in carboxylesterase genes and susceptibility to isoniazid-induced hepatotoxicity.
18794728 2008 Structure and characterization of human carboxylesterase 1A1, 1A2, and 1A3 genes.
17264798 2007 Human carboxylesterase 1A2 expressed from carboxylesterase 1A1 and 1A2 genes is a potent predictor of CPT-11 cytotoxicity in vitro.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10452915 1999 Human carboxylesterases in term placentae: enzymatic characterization, molecular cloning and evidence for the existence of multiple forms.